Property Summary

NCBI Gene PubMed Count 33
Grant Count 9
R01 Count 5
Funding $217,426.62
PubMed Score 37.64
PubTator Score 11.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.800 0.000
osteosarcoma -3.469 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.003
intraductal papillary-mucinous carcinoma... -1.200 0.036

Gene RIF (12)

PMID Text
26044651 the data presented here suggest that CEA promoter-targeted exogenous RPL23 expression could be of therapeutic value against human colorectal carcinoma that retains wt-p53.
23933826 the data presented here demonstrate that co-transduction of RPL23 enhances the therapeutic efficacy of adenoviral-mediated p53 gene transfer in models of human gastric cancer and support the use of this strategy for cancer treatment.
23160375 L23 is a novel oncogene in the squamous cell carcinoma of the head and neck
22944692 HIV-1 Rev interacting protein, ribosomal protein L23 (RPL23), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22580751 Increased RPL23 expression is found in patients with higher-risk myelodysplastic syndrome (MDS) than in patients with lower-risk disease.
22174317 HIV-1 Rev interacting protein, ribosomal protein L23 (RPL23), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
20016921 HIV-1 Rev interacting protein, ribosomal protein L23 (RPL23), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
19160485 The ribosomal protein L23 is a negative regulator of Miz1-dependent transactivation.
15314174 Data show that, when overexpressed, ribosomal protein L23 inhibits HDM2-induced p53 polyubiquitination and degradation and causes a p53-dependent cell cycle arrest.
15314173 These results reveal that ribosomal protein L23 is another regulator of the p53-MDM2 feedback regulation involved in cell growth.
More...

AA Sequence

MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKP      1 - 70
ELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNAGSIA     71 - 140
//

Text Mined References (38)

PMID Year Title
26044651 2015 Growth inhibitory effect of adenovirus-mediated tissue-targeted expression of ribosomal protein L23 on human colorectal carcinoma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23933826 2013 Co-transduction of ribosomal protein L23 enhances the therapeutic efficacy of adenoviral-mediated p53 gene transfer in human gastric cancer.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23160375 2013 A novel approach to biomarker discovery in head and neck cancer using an autoantibody signature.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...