Property Summary

NCBI Gene PubMed Count 33
PubMed Score 38.07
PubTator Score 11.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.100 2.7e-03
intraductal papillary-mucinous carcinoma... -1.200 3.6e-02
osteosarcoma -3.469 6.2e-09
psoriasis -1.800 1.3e-04

Gene RIF (12)

AA Sequence

MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKP      1 - 70
ELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNAGSIA     71 - 140
//

Text Mined References (39)

PMID Year Title