Property Summary

NCBI Gene PubMed Count 219
PubMed Score 315.97
PubTator Score 962.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.172 9.0e-06
invasive ductal carcinoma -1.072 5.8e-04
Multiple myeloma 1.905 1.7e-04
nasopharyngeal carcinoma 1.300 3.9e-05
ovarian cancer -1.500 6.1e-04
Waldenstrons macroglobulinemia 1.083 9.1e-03

 GWAS Trait (1)

Gene RIF (126)

AA Sequence

MAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQE      1 - 70
KFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHR     71 - 140
KKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALP    141 - 210
DEDDDL                                                                    211 - 216
//

Text Mined References (230)

PMID Year Title