Property Summary

NCBI Gene PubMed Count 202
Grant Count 78
R01 Count 55
Funding $10,221,460.95
PubMed Score 303.76
PubTator Score 962.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.083 0.009
Multiple myeloma 1.905 0.000
acute quadriplegic myopathy 1.172 0.000
invasive ductal carcinoma -1.072 0.001
nasopharyngeal carcinoma 1.300 0.000
ovarian cancer -1.500 0.001

Synonym

Gene

RAN

PDB

4C0Q   4OL0   1IBR   5DLQ   3ZJY   5DHF   1I2M   1K5D   1K5G   1QBK   1RRP   2MMC   2MMG   2N1B   3CH5   3EA5   3GJ0   3GJ3   3GJ4   3GJ5   3GJ6   3GJ7   3GJ8   3GJX   3NBY   3NBZ   3NC0   3NC1   4GMX   4GPT   4HAT   4HAU   4HAV   4HAW   4HAX   4HAY   4HAZ   4HB0   4HB2   4HB3   4HB4   4WVF   5CIQ   5CIT   5CIW   5CJ2   5CLL   5CLQ   5DH9   5DHA   5DI9   5DIF   5DIS   5FYQ   5JLJ  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
493048 confirmatory 11 / 0 / 29 RanGTP-Importin-beta complex Measured in Biochemical System Using Plate Reader - 2041-01_Inhibitor_Dose_DryPowder_Activity
540253 confirmatory 242 / 15675 / 325034 qHTS Assay for Inhibitors of RanGTP induced Rango (Ran-regulated importin-beta cargo) - Importin beta complex dissociation
540262 summary 0 / 0 / 0 Inhibitors of RanGTP induced Rango (Ran-regulated importin-beta cargo) - Importin beta complex dissociation: Summary

Gene RIF (127)

PMID Text
26725228 RAN is pivotal in linking spatiotemporal control of centrosome regulators to the cell cycle machinery.
26581983 Enterovirus 71-induced downregulation of miR-197 expression increased the expression of RAN, which supported the nuclear transport of the essential viral proteins 3D/3CD and host protein hnRNP K for viral replication.
26481147 Data show that RNA-binding protein LIN28B coordinates the expression of the oncogene RAN protein and aurora A kinase (AURKA) in neuroblastoma.
26438829 Elevated metaphase RanGTP levels use Ubr5 to couple overall chromosome congression to SAC silencing.
26272610 comparison of the GTPase reaction of the slower hydrolyzing GTPase Ran with Ras
26147304 Variations in RAN rs14035of Korean patients are significantly associated with their risk of colorectal cancer.
26056081 FGF2 nuclear translocation is regulated by Karyopherin-beta2 and Ran GTPase in human glioblastoma cells
25894517 Inter-cellular transport of ran GTPase
25748139 Data show that importin-beta (impbeta) alters the nuclear pore's permeability in a Ran-dependent manner, suggesting that impbeta is a functional component of the nuclear pore complex (NPC).
25723178 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
More...

AA Sequence

MAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQE      1 - 70
KFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHR     71 - 140
KKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALP    141 - 210
DEDDDL                                                                    211 - 216
//

Text Mined References (212)

PMID Year Title
26725228 2016 The GTPase RAN regulates multiple steps of the centrosome life cycle.
26581983 2015 Host MicroRNA miR-197 Plays a Negative Regulatory Role in the Enterovirus 71 Infectious Cycle by Targeting the RAN Protein.
26481147 2015 A LIN28B-RAN-AURKA Signaling Network Promotes Neuroblastoma Tumorigenesis.
26438829 2015 RanGTP aids anaphase entry through Ubr5-mediated protein turnover.
26272610 2015 Catalysis of GTP hydrolysis by small GTPases at atomic detail by integration of X-ray crystallography, experimental, and theoretical IR spectroscopy.
26147304 2015 3'-UTR Polymorphisms in the MiRNA Machinery Genes DROSHA, DICER1, RAN, and XPO5 Are Associated with Colorectal Cancer Risk in a Korean Population.
26056081 2015 Nuclear translocation of fibroblast growth factor-2 (FGF2) is regulated by Karyopherin-?2 and Ran GTPase in human glioblastoma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25894517 2015 Inter-cellular transport of ran GTPase.
25748139 2015 Importin-? modulates the permeability of the nuclear pore complex in a Ran-dependent manner.
More...