Property Summary

NCBI Gene PubMed Count 78
PubMed Score 254.02
PubTator Score 152.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.174 1.9e-06
group 4 medulloblastoma 1.100 3.9e-02
intraductal papillary-mucinous adenoma (... 1.100 4.9e-02
lung adenocarcinoma 1.873 2.4e-07
lung cancer -1.100 3.9e-04
medulloblastoma, large-cell -1.100 1.8e-05
Multiple myeloma 1.770 5.2e-04
non primary Sjogren syndrome sicca 1.600 1.6e-02
osteosarcoma 2.496 2.0e-05
ovarian cancer -1.600 3.7e-03

Protein-protein Interaction (9)

PDB (11)

Gene RIF (40)

AA Sequence

MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQ      1 - 70
ERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAK     71 - 140
EFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC         141 - 205
//

Text Mined References (89)

PMID Year Title