Property Summary

NCBI Gene PubMed Count 66
Grant Count 30
R01 Count 19
Funding $2,276,319.96
PubMed Score 242.54
PubTator Score 152.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (30)

PMID Text
26953259 Rab1A isoform 3 shows enhanced basal activity and is not controlled by accessory proteins
26308575 Rab1A-dependent activation of mTORC1 has as role in amino acid signaling promotes growth and metastasis of hepatocellular carcinomas
26298469 Results demonstrate that ALS-mutant forms of TDP-43, FUS, and SOD1 all perturb protein transport in the early secretory pathway between ER and Golgi compartments, and imply that restoring Rab1-mediated ER-Golgi transport is a novel ALS therapeutic target
26023735 Overexpression of RAB1A is associated with hepatocellular carcinoma.
25649263 Rab1A regulates anterograde melanosome transport by recruiting kinesin-1 to melanosomes through interaction with SKIP
25462347 Vaccinia virus can be added to the growing list of viruses which require RAB1A for optimal replication, highlighting this protein as a broadly proviral host factor.
25446900 hyperactive amino acid signaling through Rab1A overexpression drives oncogenesis and renders cancer cells prone to mTORC1-targeted therapy.
24801886 Rab1A knockdown induced cell death by inhibition of autophagosome formation.
24407591 These data indicate that Rab1a is an important regulator of early endosome sorting for multiple cargo species.
23939344 Rab1A can rescue the Golgi fragmentation caused by the overabundance of alpha-synuclein in nigral dopaminergic neurons, improving the ability of the surviving neurons to control motor function in hemiparkinsonian animals.
More...

AA Sequence

MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQ      1 - 70
ERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAK     71 - 140
EFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC         141 - 205
//

Text Mined References (78)

PMID Year Title
26953259 2016 Regulatory Implications of Non-Trivial Splicing: Isoform 3 of Rab1A Shows Enhanced Basal Activity and Is Not Controlled by Accessory Proteins.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26308575 2015 Aberrant amino acid signaling promotes growth and metastasis of hepatocellular carcinomas through Rab1A-dependent activation of mTORC1 by Rab1A.
26298469 2015 Rab1-dependent ER-Golgi transport dysfunction is a common pathogenic mechanism in SOD1, TDP-43 and FUS-associated ALS.
26023735 2015 miR-15b-5p induces endoplasmic reticulum stress and apoptosis in human hepatocellular carcinoma, both in vitro and in vivo, by suppressing Rab1A.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25649263 2015 Rab1A regulates anterograde melanosome transport by recruiting kinesin-1 to melanosomes through interaction with SKIP.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25462347 2015 RAB1A promotes Vaccinia virus replication by facilitating the production of intracellular enveloped virions.
25446900 2014 Rab1A is an mTORC1 activator and a colorectal oncogene.
More...