Property Summary

NCBI Gene PubMed Count 19
PubMed Score 22.66
PubTator Score 2.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active ulcerative colitis 1.160 3.3e-02
atypical teratoid / rhabdoid tumor 1.400 1.9e-02
Breast cancer 2.100 1.2e-06
breast carcinoma 1.100 5.8e-04
colon cancer -1.700 3.0e-03
cutaneous lupus erythematosus 1.400 1.4e-02
cystic fibrosis 1.008 3.9e-04
ductal carcinoma in situ 2.300 2.6e-02
glioblastoma 1.200 1.7e-02
interstitial cystitis 1.200 9.5e-03
invasive ductal carcinoma 2.800 3.7e-03
lung adenocarcinoma 1.500 1.9e-08
lung cancer 2.000 2.6e-04
malignant mesothelioma -2.100 4.7e-08
non-small cell lung cancer 1.067 3.5e-07
ovarian cancer 1.100 8.6e-03
pancreatic cancer 1.400 8.9e-03
pancreatic carcinoma 1.400 8.9e-03
psoriasis -1.300 8.0e-04

Gene RIF (7)

AA Sequence

MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Text Mined References (39)

PMID Year Title