Property Summary

NCBI Gene PubMed Count 18
PubMed Score 22.10
PubTator Score 2.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
pancreatic cancer 1.500 0.001
malignant mesothelioma -2.100 0.000
cutaneous lupus erythematosus 1.400 0.014
psoriasis 1.900 0.000
cystic fibrosis 1.700 0.000
atypical teratoid / rhabdoid tumor 1.400 0.019
glioblastoma 1.200 0.017
non-small cell lung cancer 1.067 0.000
lung cancer 2.700 0.000
colon cancer -1.700 0.003
ulcerative colitis 1.200 0.013
breast carcinoma 1.100 0.001
interstitial cystitis 1.200 0.010
pancreatic carcinoma 1.400 0.009
lung adenocarcinoma 1.500 0.000
Breast cancer 1.700 0.000
ductal carcinoma in situ 2.300 0.026
invasive ductal carcinoma 2.800 0.004
ovarian cancer 1.100 0.009

Synonym

Accession P62807 P02278 Q3B872 Q4VB69 Q93078 Q93080
Symbols H2B.1
H2B/l
H2BFL
dJ221C16.3

Gene

PDB

5KGF  

 GO Function (1)

Gene RIF (7)

PMID Text
22174317 HIV-1 Rev interacting protein, histone cluster 1, H2bc, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22082156 Knockdown of histone cluster 1, H2bc (HIST1H2BC) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
14657027 HIV-1 Rev interacting protein, histone cluster 1, H2bc, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
12860195 Histone H2B antimicrobial peptides participate in the colonic defense against bacteria and fungi.
11689053 HIV-1 Rev interacting protein, histone cluster 1, H2bc, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11080476 HIV-1 Rev interacting protein, histone cluster 1, H2bc, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9566873 HIV-1 Rev interacting protein, histone cluster 1, H2bc, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Text Mined References (34)

PMID Year Title
27402160 2016 A subset of replication-dependent histone mRNAs are expressed as polyadenylated RNAs in terminally differentiated tissues.
25416956 2014 A proteome-scale map of the human interactome network.
23824326 2013 USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22121020 2011 GlcNAcylation of histone H2B facilitates its monoubiquitination.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19414484 2009 Genome-wide association meta-analysis for total serum bilirubin levels.
More...