Property Summary

NCBI Gene PubMed Count 94
PubMed Score 144.50
PubTator Score 41.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
acute myeloid leukemia -1.700 2.2e-02
astrocytic glioma -1.200 3.5e-02
astrocytoma -1.200 3.3e-02
Astrocytoma, Pilocytic -1.300 5.1e-03
atypical teratoid / rhabdoid tumor -1.800 2.8e-04
Breast cancer 2.400 4.8e-08
breast carcinoma 1.200 1.3e-04
colon cancer 1.300 1.0e-02
cystic fibrosis 1.309 7.4e-05
diabetes mellitus -1.600 9.6e-03
ductal carcinoma in situ 2.300 8.5e-03
Endometriosis 1.087 2.2e-02
glioblastoma -1.300 1.2e-02
hepatocellular carcinoma 1.100 1.2e-02
inflammatory breast cancer 1.400 2.4e-03
invasive ductal carcinoma 3.600 2.3e-03
lung adenocarcinoma 1.200 5.4e-09
lung cancer 1.200 6.0e-03
lung carcinoma 1.100 1.6e-12
malignant mesothelioma -1.600 7.8e-07
Multiple Sclerosis -1.500 1.6e-03
non-small cell lung carcinoma 1.300 2.6e-19
osteosarcoma 2.916 1.6e-05
pancreatic cancer 2.100 2.1e-04
pancreatic carcinoma 2.100 2.1e-04
Pick disease 1.200 1.2e-05
psoriasis 4.300 2.4e-06
ulcerative colitis -1.537 3.2e-03

Synonym

Accession P62805 A2VCL0 P02304 P02305 Q6DRA9 Q6FGB8 Q6NWP7
Symbols H4
H4/n
H4F2
H4FN
FO108
HIST2H4

Gene

PDB

5GSU   5GT0   4Z2M   2RJE   4U9W   5BNX   5BO0   4QUT   4QUU   3QZS   3QZT   3QZV   2IG0   2LVM   2CV5   3A6N   3AFA   3AN2   3AV1   3AV2   3AYW   3AZE   3AZF   3AZG   3AZH   3AZI   3AZJ   3AZK   3AZL   3AZM   3AZN   3W96   3W97   3W98   3W99   3WKJ   3WTP   3X1S   3X1V   4YM5   4YM6   4Z5T   5AV5   5AV6   5AV8   5AV9   5AVB   5AVC   5AY8   5B0Y   5B0Z   5B24   5B2I   5B2J   5B31   5B32   5B40   5CPI   5CPJ   5CPK   5GSE   5GTC   5GXQ   5JRG   5X7X   5XF3   5XF4   5XF5   3NQJ   3NQU   3R45   3O36   3WAA   4H9N   4H9O   4H9P   4H9Q   4H9R   4H9S   4HGA   5B33   5BNV   5JA4   5KDM   1ZKK   2BQZ   2KWN   2KWO   2QQS   2RNY   2RS9   3CFS   3CFV   3F9W   3F9X   3F9Y   3F9Z   3IJ1   3JPX   3QBY   3UVW   3UVX   3UVY   3UW9   3WA9   3X1T   3X1U   4GQB   4M38   4N3W   4N4F   4QYD   4YY6   4YYD   4YYG   4YYH   4YYI   4YYJ   4YYK   4YYM   4YYN   5C3I   5FA5   5FFW   5FWE   5GT3   5TEG  

Gene RIF (9)

AA Sequence

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA      1 - 70
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG                                          71 - 103
//

Text Mined References (136)

PMID Year Title