Property Summary

NCBI Gene PubMed Count 76
PubMed Score 138.46
PubTator Score 41.23

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
non-small cell lung carcinoma 413 2.57571491200556E-19
breast carcinoma 1614 2.84874018550629E-17
lung carcinoma 2844 1.55458005204476E-12
lung adenocarcinoma 2714 9.9254637219796E-9
Breast cancer 3099 3.54362484550249E-6
malignant mesothelioma 3163 1.04805195088822E-5
Pick disease 1893 1.18116464529778E-5
osteosarcoma 7933 1.64021002877622E-5
cystic fibrosis 1670 7.39317354807507E-5
pancreatic cancer 2300 2.09396888555437E-4
pancreatic carcinoma 567 2.09396888555438E-4
atypical teratoid / rhabdoid tumor 4369 2.77245814835653E-4
Multiple Sclerosis 498 0.00158156712151261
lung cancer 4473 0.00177994964232563
ulcerative colitis 2087 0.00324856551213146
pilocytic astrocytoma 3086 0.00426718882821608
inflammatory breast cancer 404 0.0049884355592966
psoriasis 6685 0.00515630339614967
invasive ductal carcinoma 2950 0.00609520887308601
ductal carcinoma in situ 1745 0.00853123139821749
diabetes mellitus 1663 0.0095563032682763
colon cancer 1475 0.0102007787187017
hepatocellular carcinoma 550 0.0119524118293261
glioblastoma 5572 0.0121041908917892
Endometriosis 535 0.0220750355788004
astrocytoma 1493 0.0331638656591482
astrocytic glioma 2241 0.0345841583688963
acute myeloid leukemia 785 0.0462121596207178
Disease Target Count Z-score Confidence
Cancer 2346 4.408 2.2


  Differential Expression (28)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.012
pancreatic cancer 2.100 0.000
malignant mesothelioma -1.600 0.000
astrocytic glioma -1.200 0.035
psoriasis 4.300 0.000
osteosarcoma 2.916 0.000
cystic fibrosis 1.309 0.000
astrocytoma -1.200 0.033
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.300 0.012
ulcerative colitis -1.537 0.003
lung cancer 1.400 0.000
colon cancer 1.300 0.010
breast carcinoma 1.200 0.000
diabetes mellitus -1.600 0.010
Multiple Sclerosis -1.500 0.002
lung adenocarcinoma 1.200 0.000
pilocytic astrocytoma -1.300 0.004
pancreatic carcinoma 2.100 0.000
Endometriosis 1.087 0.022
inflammatory breast cancer 1.400 0.002
lung carcinoma 1.100 0.000
non-small cell lung carcinoma 1.300 0.000
Pick disease 1.200 0.000
Breast cancer 2.400 0.000
ductal carcinoma in situ 2.300 0.009
invasive ductal carcinoma 3.600 0.002
acute myeloid leukemia -1.700 0.022


Accession P62805 A2VCL0 P02304 P02305 Q6DRA9 Q6FGB8 Q6NWP7
Symbols H4



4Z2M   2RJE   4U9W   5BNX   5BO0   4QUT   4QUU   3QZS   3QZT   3QZV   2IG0   2LVM   2CV5   3A6N   3AFA   3AN2   3AV1   3AV2   3AYW   3AZE   3AZF   3AZG   3AZH   3AZI   3AZJ   3AZK   3AZL   3AZM   3AZN   3W96   3W97   3W98   3W99   3WKJ   3WTP   3X1S   3X1V   4YM5   4YM6   4Z5T   5AV5   5AV6   5AV8   5AV9   5AVB   5AVC   5AY8   5B0Y   5B0Z   5B24   5B2I   5B2J   5B31   5B32   5B40   5CPI   5CPJ   5CPK   3NQJ   3NQU   3R45   3O36   3WAA   4H9N   4H9O   4H9P   4H9Q   4H9R   4H9S   4HGA   5B33   5BNV   5JA4   1ZKK   2BQZ   2KWN   2KWO   2QQS   2RNY   2RS9   3CFS   3CFV   3F9W   3F9X   3F9Y   3F9Z   3IJ1   3JPX   3QBY   3UVW   3UVX   3UVY   3UW9   3WA9   3X1T   3X1U   4GQB   4M38   4N3W   4N4F   4QYD   4YY6   4YYD   4YYG   4YYH   4YYI   4YYJ   4YYK   4YYM   4YYN   5C3I   5FA5   5FFW   5FWE   5KDM  

  Ortholog (2)

Species Source
Mouse OMA Inparanoid
Chicken OMA Inparanoid

Gene RIF (9)

22195965 NASP balances the activity of the heat shock proteins Hsc70 and Hsp90 to direct H3-H4 for degradation by chaperone-mediated autophagy
21994445 H2B and H4 histones were mobilized during herpes simplex virus 1 infection and became available to bind to viral genomes.
19234465 Loss of the H4 arginine 3 methylation mark through short hairpin RNA-mediated knockdown of PRMT5 leads to reduced DNMT3A binding, loss of DNA methylation and gene activation.
15823041 deiminated residues were present in H2A (1-56) and H4 (1-52)
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
12556504 assessed the functional coupling between chromatin organization and regulation of histone H4/n gene expression during HL-60 differentiation into the monocyte/macrophage lineage
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG                                          71 - 103

Text Mined References (112)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25615412 2015 Human tNASP promotes in vitro nucleosome assembly with histone H3.3.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25416956 2014 A proteome-scale map of the human interactome network.
25281266 2014 Structural insights into recognition of acetylated histone ligands by the BRPF1 bromodomain.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24699735 2014 Structure of human nucleosome containing the testis-specific histone variant TSH2B.
24596249 2014 Molecular functions of the TLE tetramerization domain in Wnt target gene repression.
24525235 2014 Disrupting the interaction of BRD4 with diacetylated Twist suppresses tumorigenesis in basal-like breast cancer.