Property Summary

NCBI Gene PubMed Count 74
Grant Count 79
R01 Count 64
Funding $6,440,706.61
PubMed Score 472.45
PubTator Score 279.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.400 0.001
lung cancer -3.800 0.042

Synonym

Accession P62753 P08227 P10660 Q4VBY7 Q8N6Z7
Symbols S6

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

Gene RIF (40)

PMID Text
26506236 Data suggest ribosomal protein S6 (rpS6) as tumor marker for renal cell carcinoma.
26490682 Hyperphosphorylation of ribosomal protein S6 predicts unfavorable clinical survival in non-small cell lung cancer
26362536 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
26329528 p-rpS6 is a robust post-treatment indicator of HER2 pathway-targeted therapy resistance
25704763 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
25659153 Tanshinone IIA inhibits HIF-1alpha and VEGF expression in breast cancer cells via mTOR/p70S6K/RPS6/4E-BP1 signaling pathway.
25379021 Resistance to Selumetinib (AZD6244) in colorectal cancer cell lines is mediated by p70S6K and RPS6 activation.
24886512 The expression levels of phospho-mTOR and phospho-S6RP may be potential predictive biomarkers for efficacy of everolimus in patients with metastatic renal cell carcinoma.
24831086 we report that phosphorylation of ribosomal protein S6 is greatly increased in BRCA1 deficient cells resistant to PARP inhibition
23765247 Suggest phosphorylated S6 as an immunohistochemical biomarker of vulvar intraepithelial neoplasia.
More...

AA Sequence

MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTH      1 - 70
GRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASR     71 - 140
IRKLFNLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYA    141 - 210
KLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK                                   211 - 249
//

Text Mined References (87)

PMID Year Title
26506236 2016 The ribosomal protein S6 in renal cell carcinoma: functional relevance and potential as biomarker.
26490682 2015 Hyperphosphorylation of ribosomal protein S6 predicts unfavorable clinical survival in non-small cell lung cancer.
26329528 2015 Phosphorylated ribosomal S6 (p-rpS6) as a post-treatment indicator of HER2 signalling targeted drug resistance.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25659153 2015 Tanshinone IIA inhibits HIF-1? and VEGF expression in breast cancer cells via mTOR/p70S6K/RPS6/4E-BP1 signaling pathway.
25379021 2014 Resistance to Selumetinib (AZD6244) in colorectal cancer cell lines is mediated by p70S6K and RPS6 activation.
24886512 2014 Phosphorylation of mTOR and S6RP predicts the efficacy of everolimus in patients with metastatic renal cell carcinoma.
24831086 2014 Phosphorylation of ribosomal protein S6 confers PARP inhibitor resistance in BRCA1-deficient cancers.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23765247 2013 Phosphorylated S6 as an immunohistochemical biomarker of vulvar intraepithelial neoplasia.
More...