Property Summary

NCBI Gene PubMed Count 79
PubMed Score 501.55
PubTator Score 279.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.400 7.5e-04
lung cancer 1.100 4.6e-04

Gene RIF (41)

AA Sequence

MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTH      1 - 70
GRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASR     71 - 140
IRKLFNLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYA    141 - 210
KLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK                                   211 - 249
//

Text Mined References (94)

PMID Year Title