Property Summary

NCBI Gene PubMed Count 23
PubMed Score 24.55
PubTator Score 12.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Parkinson Disease 64 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Cutaneous leishmaniasis 4 3.169 1.6

Expression

Gene RIF (1)

AA Sequence

MAPKAKKEAPAPPKAEAKAKALKAKKAVLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNK      1 - 70
LDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRL     71 - 140
APDYDALDVANKIGII                                                          141 - 156
//

Text Mined References (35)

PMID Year Title