Property Summary

NCBI Gene PubMed Count 23
Grant Count 62
R01 Count 5
Funding $40,322,507
PubMed Score 23.37
PubTator Score 12.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession P62750 B2R5B2 P29316 P39024 Q92774
Symbols L23A
MDA20

Gene

PDB

4UG0   4V6X   5AJ0  

Gene RIF (1)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ribosomal protein L23a (RPL23A) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MAPKAKKEAPAPPKAEAKAKALKAKKAVLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNK      1 - 70
LDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRL     71 - 140
APDYDALDVANKIGII                                                          141 - 156
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...