Property Summary

NCBI Gene PubMed Count 119
PubMed Score 272.24
PubTator Score 194.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
active ulcerative colitis 1.607 1.1e-02
acute quadriplegic myopathy 2.367 1.5e-05
astrocytoma 1.700 1.1e-02
atypical teratoid / rhabdoid tumor -1.300 1.5e-04
autosomal dominant Emery-Dreifuss muscul... 1.653 8.2e-03
chronic rhinosinusitis -1.573 9.3e-03
colon cancer -1.600 2.3e-03
cystic fibrosis 1.100 1.2e-04
dermatomyositis -2.200 1.1e-02
Down syndrome 1.100 7.4e-04
ependymoma 2.800 5.6e-03
gastric cancer -2.300 1.7e-02
Gaucher disease type 1 1.600 3.6e-02
glioblastoma 1.100 1.4e-02
group 3 medulloblastoma -1.300 2.6e-04
juvenile dermatomyositis 1.008 2.3e-05
lung cancer -1.800 5.9e-05
malignant mesothelioma -1.700 2.5e-07
medulloblastoma, large-cell 1.300 4.4e-03
Multiple myeloma 1.926 2.1e-03
non-small cell lung cancer -1.191 5.4e-12
oligodendroglioma 2.500 3.2e-03
osteosarcoma 3.330 1.1e-05
ovarian cancer -1.100 9.2e-04
pancreatic cancer -2.200 2.2e-02
pancreatic carcinoma -2.200 2.2e-02
pituitary cancer -1.700 6.2e-03
primary pancreatic ductal adenocarcinoma 1.427 1.3e-02
psoriasis -1.300 2.6e-06
subependymal giant cell astrocytoma -2.186 3.0e-02

Gene RIF (91)

AA Sequence

MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR      1 - 70
PLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVR     71 - 140
TDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL                  141 - 196
//

Text Mined References (121)

PMID Year Title