Property Summary

NCBI Gene PubMed Count 111
Grant Count 78
R01 Count 69
Funding $6,368,794.55
PubMed Score 254.71
PubTator Score 194.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
gastric cancer -2.600 0.001
pancreatic cancer -2.300 0.003
Multiple myeloma 1.926 0.002
malignant mesothelioma -1.700 0.000
ependymoma 2.800 0.006
oligodendroglioma 2.500 0.003
psoriasis -4.000 0.000
osteosarcoma 3.330 0.000
astrocytoma 1.700 0.011
glioblastoma 1.200 0.032
atypical teratoid/rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell 1.300 0.004
autosomal dominant Emery-Dreifuss muscul... 1.653 0.008
juvenile dermatomyositis 1.008 0.000
acute quadriplegic myopathy 2.367 0.000
primary pancreatic ductal adenocarcinoma 1.427 0.013
non-small cell lung cancer -1.191 0.000
lung cancer -2.900 0.000
colon cancer -1.600 0.002
active ulcerative colitis 1.607 0.011
cystic fibrosis 1.100 0.000
group 3 medulloblastoma -1.300 0.000
pancreatic carcinoma -2.300 0.003
subependymal giant cell astrocytoma -2.186 0.030
ovarian cancer 1.300 0.006
Gaucher disease type 1 1.600 0.036
pituitary cancer -2.100 0.000
Down syndrome 1.100 0.001
chronic rhinosinusitis -1.573 0.009
dermatomyositis -2.200 0.011

Synonym

Accession P62745 B2R692 P01121 Q5U0H6 Q7RTN5 Q7RTR9 Q9CUV7
Symbols ARH6
ARHB
RHOH6
MST081
MSTP081

Gene

PDB

2FV8  

Gene RIF (83)

PMID Text
26759237 Stimulating its ability to activate the antimetastatic small GTPase RhoB.
26741994 The knockdown of RhoB protein decreased the proliferation rate of the parental and the IE1-expressing glioblastoma cells.
26148238 we propose that RhoB could be responsible for early metastatic prevention by inhibiting the EMT-derived invasiveness of lung cells through the control of PP2A activity.
25630770 RhoB depletion reduces cell-cell adhesion and downregulates E-cadherin levels as well as increasing internalized E-cadherin in DU145 prostate cancer cells.
25540389 Findings highlight the degradation of RhoB via the neddylation-CRL pathway as an important molecular event that drives liver carcinogenesis.
25486363 Net1A plays a plays a previously unrecognized, Rho GTPase-independent role in controlling ATM activity and downstream signaling after DNA damage to impact cell survival.
25470816 Results support previous findings that vaiants in the RHOB and FAM167A-BLK genes may be associated with susceptibility to systemic sclerosis.
25454559 Despite RhoA and RhoB GTPases are different in their biological roles, no significant difference in immunoexpression of the RhoA and RhoB GTPases in epithelial and mesenchymal structures of parotid.
25320360 We showed that RhoB is not only a strong prognostic factor in NSCLC but it is also critical for the acquisition of an aggressive phenotype of adenocarcinoma.
25249323 Suppressing RhoB levels by overexpressing Smurf1 or blocking Chk1-dependent Smurf1 self-degradation significantly inhibits apoptosis.
More...

AA Sequence

MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR      1 - 70
PLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVR     71 - 140
TDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL                  141 - 196
//

Text Mined References (113)

PMID Year Title
26759237 2016 RASSF1A Suppresses the Invasion and Metastatic Potential of Human Non-Small Cell Lung Cancer Cells by Inhibiting YAP Activation through the GEF-H1/RhoB Pathway.
26741994 2016 The Role of RhoA, RhoB and RhoC GTPases in Cell Morphology, Proliferation and Migration in Human Cytomegalovirus (HCMV) Infected Glioblastoma Cells.
26148238 2016 RhoB loss induces Rac1-dependent mesenchymal cell invasion in lung cells through PP2A inhibition.
25630770 2015 The Rho GTPase RhoB regulates cadherin expression and epithelial cell-cell interaction.
25540389 2015 The neddylation-cullin 2-RBX1 E3 ligase axis targets tumor suppressor RhoB for degradation in liver cancer.
25486363 2014 Rho GTPase independent regulation of ATM activation and cell survival by the RhoGEF Net1A.
25470816 2014 Possible single-nucleotide polymorphism loci associated with systemic sclerosis susceptibility: a genetic association study in a Chinese Han population.
25454559 2014 Immunolocalization of RhoA and RhoB GTPases in pleomorphic adenoma of the parotid.
25320360 2014 RhoB determines tumor aggressiveness in a murine EGFRL858R-induced adenocarcinoma model and is a potential prognostic biomarker for Lepidic lung cancer.
25249323 2014 ATR/Chk1/Smurf1 pathway determines cell fate after DNA damage by controlling RhoB abundance.
More...