Property Summary

NCBI Gene PubMed Count 146
PubMed Score 161.38
PubTator Score 179.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
lung cancer 4740 0.0 1.7

Expression

  Differential Expression (22)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.300 1.4e-04
Breast cancer -2.800 3.0e-14
breast carcinoma -1.400 5.0e-25
colon cancer -1.800 2.5e-04
cystic fibrosis -3.239 7.6e-07
ependymoma 1.300 8.1e-05
glioblastoma 2.600 4.4e-03
intraductal papillary-mucinous adenoma (... -2.800 6.4e-04
intraductal papillary-mucinous carcinoma... -3.500 2.2e-03
intraductal papillary-mucinous neoplasm ... -2.200 2.1e-02
malignant mesothelioma -5.300 8.5e-09
nasopharyngeal carcinoma 1.500 5.0e-04
nephrosclerosis 1.144 5.7e-03
ovarian cancer -1.800 4.6e-03
pancreatic cancer 1.100 7.4e-03
Pick disease 1.400 1.4e-02
primary pancreatic ductal adenocarcinoma 4.600 1.2e-05
psoriasis -1.100 2.2e-03
pterygium 1.200 1.4e-02
tuberculosis 1.500 1.2e-05
type II diabetes mellitus and post-ische... 1.200 1.2e-02
urothelial carcinoma 2.500 1.2e-02

Protein-protein Interaction (10)

Gene RIF (147)

AA Sequence

MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK      1 - 70
YPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA     71 - 140
VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI    141 - 210
VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT    211 - 280
YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS    281 - 350
LSTFQQMWISKQEYDEAGPSIVHRKCF                                               351 - 377
//

Text Mined References (150)

PMID Year Title