Property Summary

NCBI Gene PubMed Count 45
PubMed Score 11.13
PubTator Score 12.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 3.13438628606037E-14
tuberculosis and treatment for 6 months 686 2.00008677039845E-5
ovarian cancer 8492 7.23778175119908E-5
medulloblastoma, large-cell 6234 9.97557476873158E-5
psoriasis 6685 2.08716124283678E-4
adult high grade glioma 2148 2.09938647812933E-4
glioblastoma 5572 3.15890680352926E-4
atypical teratoid / rhabdoid tumor 4369 4.63327943892689E-4
osteosarcoma 7933 4.98818853201444E-4
Multiple myeloma 1328 0.0032537607598422
group 4 medulloblastoma 1875 0.0135136365085985
subependymal giant cell astrocytoma 2287 0.0153694602726479
Disease Target Count Z-score Confidence
Werner syndrome 29 3.889 1.9

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.352 0.003
psoriasis 1.100 0.000
osteosarcoma 1.401 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -2.100 0.000
tuberculosis and treatment for 6 months -1.300 0.000
lung adenocarcinoma -1.800 0.000
adult high grade glioma -2.000 0.000
group 4 medulloblastoma -1.300 0.014
subependymal giant cell astrocytoma -1.153 0.015
ovarian cancer -2.000 0.000

Synonym

Accession P62714 D3DSV4 P11082 Q6FHK5 PP2A-beta
Symbols PP2CB
PP2Abeta

Gene

  Ortholog (11)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae OMA EggNOG

 MGI Term (1)

Gene RIF (16)

PMID Text
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
23047923 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
22422068 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
22190034 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21317290 The GAS41-PP2Cbeta complex dephosphorylates p53 at serine 366 and regulates its stability
21072166 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
18971272 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
18483222 PP2B and PP1alpha cooperatively disrupt 7SK snRNP to release P-TEFb for transcription in response to Ca2+ signaling.
18460741 These data strongly support a recent proposal that a segment at 8p21.3 contains crucial prostate cancer tumor suppressors.
More...

AA Sequence

MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFR      1 - 70
IGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNA     71 - 140
NVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWG    141 - 210
ISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD    211 - 280
TLKYSFLQFDPAPRRGEPHVTRRTPDYFL                                             281 - 309
//

Text Mined References (47)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21317290 2011 The GAS41-PP2Cbeta complex dephosphorylates p53 at serine 366 and regulates its stability.
21269460 2011 Initial characterization of the human central proteome.
20969868 2010 LIM domain protein FHL1B interacts with PP2A catalytic ? subunit--a novel cell cycle regulatory pathway.
19156129 2009 An integrated workflow for charting the human interaction proteome: insights into the PP2A system.
18782753 2009 A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein.
18483222 2008 PP2B and PP1alpha cooperatively disrupt 7SK snRNP to release P-TEFb for transcription in response to Ca2+ signaling.
More...