Property Summary

NCBI Gene PubMed Count 45
Grant Count 2
R01 Count 2
Funding $99,961
PubMed Score 11.13
PubTator Score 12.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.352 0.003
psoriasis 1.100 0.000
osteosarcoma 1.401 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -2.100 0.000
tuberculosis and treatment for 6 months -1.300 0.000
lung adenocarcinoma -1.800 0.000
adult high grade glioma -2.000 0.000
group 4 medulloblastoma -1.300 0.014
subependymal giant cell astrocytoma -1.153 0.015
ovarian cancer -2.000 0.000

Synonym

Accession P62714 D3DSV4 P11082 Q6FHK5 PP2A-beta
Symbols PP2CB
PP2Abeta

Gene

 Grant Application (2)

 MGI Term (1)

Gene RIF (17)

PMID Text
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
23047923 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
22422068 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
22190034 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21317290 The GAS41-PP2Cbeta complex dephosphorylates p53 at serine 366 and regulates its stability
21072166 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
18971272 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
18483222 PP2B and PP1alpha cooperatively disrupt 7SK snRNP to release P-TEFb for transcription in response to Ca2+ signaling.
18460741 These data strongly support a recent proposal that a segment at 8p21.3 contains crucial prostate cancer tumor suppressors.
More...

AA Sequence

MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFR      1 - 70
IGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNA     71 - 140
NVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWG    141 - 210
ISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD    211 - 280
TLKYSFLQFDPAPRRGEPHVTRRTPDYFL                                             281 - 309
//

Text Mined References (47)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21317290 2011 The GAS41-PP2Cbeta complex dephosphorylates p53 at serine 366 and regulates its stability.
21269460 2011 Initial characterization of the human central proteome.
20969868 2010 LIM domain protein FHL1B interacts with PP2A catalytic ? subunit--a novel cell cycle regulatory pathway.
19156129 2009 An integrated workflow for charting the human interaction proteome: insights into the PP2A system.
18782753 2009 A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein.
18483222 2008 PP2B and PP1alpha cooperatively disrupt 7SK snRNP to release P-TEFb for transcription in response to Ca2+ signaling.
More...