Property Summary

NCBI Gene PubMed Count 51
PubMed Score 11.30
PubTator Score 12.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.000 2.1e-04
atypical teratoid / rhabdoid tumor -1.500 4.6e-04
glioblastoma -1.400 3.2e-04
group 4 medulloblastoma -1.300 1.4e-02
lung adenocarcinoma -1.100 4.3e-11
medulloblastoma, large-cell -2.100 1.0e-04
Multiple myeloma 1.352 3.3e-03
osteosarcoma 1.401 5.0e-04
ovarian cancer -2.000 7.2e-05
psoriasis 1.100 2.1e-04
subependymal giant cell astrocytoma -1.153 1.5e-02
tuberculosis and treatment for 6 months -1.300 2.0e-05

 MGI Phenotype (1)

Gene RIF (16)

AA Sequence

MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFR      1 - 70
IGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNA     71 - 140
NVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWG    141 - 210
ISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD    211 - 280
TLKYSFLQFDPAPRRGEPHVTRRTPDYFL                                             281 - 309
//

Text Mined References (54)

PMID Year Title