Property Summary

NCBI Gene PubMed Count 35
Grant Count 7
R01 Count 6
Funding $826,759.67
PubMed Score 34.61
PubTator Score 123.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -4.100 0.038
ovarian cancer -1.300 0.000

Gene RIF (8)

PMID Text
25731206 Low RPS4X expression is associated with poor disease-specific and recurrence-free survival in bladder cancer
24503063 The 3'-UTR of liver mRNA of galectin-1 and RPS4X bind to the HCV NS5B.
23800275 levels of RPS4X could be a good indicator for resistance to platinum-based therapy and a prognostic marker for ovarian cancer
23125841 Tandem affinity purification and mass spectrometry analysis identify X-linked isoform of ribosomal protein S4 (RPS4X), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify X-linked isoform of ribosomal protein S4 (RPS4X), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify X-linked isoform of ribosomal protein S4 (RPS4X), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify X-linked isoform of ribosomal protein S4 (RPS4X), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22174317 Tandem affinity purification and mass spectrometry analysis identify X-linked isoform of ribosomal protein S4 (RPS4X), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFI      1 - 70
KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLV     71 - 140
THDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHV    141 - 210
KDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG                     211 - 263
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25731206 2015 Low level of the X-linked ribosomal protein S4 in human urothelial carcinomas is associated with a poor prognosis.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24503063 2014 In vitro selection of the 3'-untranslated regions of the human liver mRNA that bind to the HCV nonstructural protein 5B.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23800275 2013 Low expression of the X-linked ribosomal protein S4 in human serous epithelial ovarian cancer is associated with a poor prognosis.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...