Property Summary

NCBI Gene PubMed Count 35
PubMed Score 35.67
PubTator Score 123.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count P-value
ovarian cancer 8520 1.7e-04
lung cancer 4740 4.2e-02
Disease Target Count Z-score Confidence
Turner syndrome 28 4.912 2.5
Glycogen storage disease I 2 3.048 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -3.500 4.2e-02
ovarian cancer -1.300 1.7e-04

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFI      1 - 70
KIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLV     71 - 140
THDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHV    141 - 210
KDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG                     211 - 263
//

Text Mined References (41)

PMID Year Title