Property Summary

NCBI Gene PubMed Count 48
PubMed Score 363.02
PubTator Score 238.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.815 4.9e-05
ovarian cancer -1.500 2.8e-04
Waldenstrons macroglobulinemia 1.069 4.9e-03

Gene RIF (31)

AA Sequence

MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQ      1 - 70
EDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRC     71 - 140
GETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA                                     141 - 177
//

Text Mined References (53)

PMID Year Title