Property Summary

NCBI Gene PubMed Count 44
Grant Count 124
R01 Count 79
Funding $13,461,649.49
PubMed Score 351.59
PubTator Score 238.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.069 0.005
Multiple myeloma 1.815 0.000
ovarian cancer -1.500 0.000

Synonym

Accession P62633 A8K7V4 B2RAV9 B4DP17 D3DNB9 D3DNC0 D3DNC1 E9PDR7 P20694 Q4JGY0 Q4JGY1 Q5QJR0 Q5U0E9 Q6PJI7 Q96NV3 CNBP
Symbols DM2
ZNF9
CNBP1
PROMM
RNF163
ZCCHC22

Gene

PANTHER Protein Class (1)

Gene RIF (27)

PMID Text
26460945 High CNBP expression is associated with Medulloblastoma.
24726729 Arginine methylation of CNBP in the RG motif does not change the subcellular localization but regulates its RNA binding activity.
24594223 CNBP overexpression caused increase of cell death and suppression of cell metastasis through its induction of G-quadruplex formation in the promoter of hnRNP K resulting in hnRNP K down-regulation
23774591 suggested a new possibility of CNBP as a potential anti-cancer target based on CNBP's biological function in c-myc transcription
23642268 CNBP are novel antigens for SLE patients and the recognition of CNBP might be differentiated dependent on the level of arginine methylation.
23285195 CNBP associates with the poly(A) binding protein and accumulates in stress granules.
22407275 The co-segregation of Myotonic dystrophy type 2 with a recessive CLCN1 mutation provided the explanation for the unusual clinical findings for juvenile onset of myotonia in a 14-year-old female with Myotonic dystrophy type 2 and her affected mother
22332444 Myotonic dystrophy 2(autosomal dominant, multisystem disorder caused by a CCTG tetranucleotide repeat expansion located in intron 1 of the zinc finger protein 9 gene (ZNF9 gene) on chromosome 3q 21.3.) described in Israeli Jewish European ancestry.
21277287 These data suggest that Gis2 is functionally orthologous to ZNF9 and acts as a cap-independent translation factor.
21224892 Study concludes that DM2 patients from the Netherlands, including a North-African family, harbor a common haplotype surrounding the ZNF9 gene.
More...

AA Sequence

MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQ      1 - 70
EDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRC     71 - 140
GETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA                                     141 - 177
//

Text Mined References (49)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26460945 2015 Non-canonical Hedgehog/AMPK-Mediated Control of Polyamine Metabolism Supports Neuronal and Medulloblastoma Cell Growth.
26002199 2015 The Repeat Expansion Diseases: The dark side of DNA repair.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24726729 2014 Arginine methylation of the cellular nucleic acid binding protein does not affect its subcellular localization but impedes RNA binding.
24594223 2014 Cellular nucleic acid binding protein suppresses tumor cell metastasis and induces tumor cell death by downregulating heterogeneous ribonucleoprotein K in fibrosarcoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23774591 2013 Mechanistic studies for the role of cellular nucleic-acid-binding protein (CNBP) in regulation of c-myc transcription.
23642268 2013 Proteomic analyses and identification of arginine methylated proteins differentially recognized by autosera from anti-Sm positive SLE patients.
More...