Property Summary

NCBI Gene PubMed Count 76
Grant Count 29
R01 Count 18
Funding $3,521,181.89
PubMed Score 149.98
PubTator Score 87.81

Knowledge Summary

Patent (6,698)

Expression

  Differential Expression (20)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (51)

PMID Text
26940882 Estrogen-related receptor gamma is upregulated in liver cancer and its inhibition suppresses liver cancer cell proliferation via induction of p21 and p27.
26051094 ESRRG is down-regulated in placenta from intrauterine growth restriction tissue.
25971350 ERRgamma signaling is associated with poor DMFS in ER+, TAM-treated breast cancer
25807177 Results suggest that hypoxia-inducible factor-1alpha can positively regulate the dopaminergic phenotype through estrogen-related receptor gamma .
25736597 Data show that micrRNA miR-320a directly targets cAMP-regulated phosphoprotein 19 (ARPP-19) and estrogen-related receptor gamma protein (ERRgamma) in breast cancer cell lines.
24978476 The results reveal that the double-layer binding sites, namely, the ordinary ligand binding sites and their back support residues, substantiate the strong binding of BPA to ERRgamma.
24725083 A role for ESRRG in maternal blood pressure homeostasis during pregnancy.
24687322 Report estrogen-mediated cell kinetics and the role of oestrogen-related receptor gamma on biliary epithelial cells in the pathogenesis of primary biliary cirrhosis.
24684682 ERRgamma protein levels are affected by the activation state of ERK/mitogen-activated protein kinase, and mutation of consensus ERK target sites impairs ERRgamma-driven transcriptional activity and tamoxifen resistance.
24125170 Iranian women with short AAAG repeat are at higher risk of breast cancer.
More...

AA Sequence

MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSS      1 - 70
TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHY     71 - 140
GVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKY    141 - 210
KRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVII    211 - 280
GWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAIL    281 - 350
QLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT    351 - 420
LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV                                    421 - 458
//

Text Mined References (82)

PMID Year Title
26940882 2016 Estrogen-related receptor ? is upregulated in liver cancer and its inhibition suppresses liver cancer cell proliferation via induction of p21 and p27.
26051094 2015 Involvement of estrogen-related receptor-? and mitochondrial content in intrauterine growth restriction and preeclampsia.
25971350 2015 ERR? target genes are poor prognostic factors in Tamoxifen-treated breast cancer.
25807177 2015 Hypoxia-inducible factor-1? upregulates tyrosine hydroxylase and dopamine transporter by nuclear receptor ERR? in SH-SY5Y cells.
25736597 2015 MicroRNA-320a sensitizes tamoxifen-resistant breast cancer cells to tamoxifen by targeting ARPP-19 and ERR?.
25416956 2014 A proteome-scale map of the human interactome network.
24978476 2014 A characteristic back support structure in the bisphenol A-binding pocket in the human nuclear receptor ERR?.
24725083 2014 Estrogen-related receptor ? serves a role in blood pressure homeostasis during pregnancy.
24687322 2014 Significance of oestrogen-related receptor ? on biliary epithelial cells in the pathogenesis of primary biliary cirrhosis.
24684682 2014 ERK/MAPK regulates ERR? expression, transcriptional activity and receptor-mediated tamoxifen resistance in ER+ breast cancer.
More...