Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.77
PubTator Score 3.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Bipolar Disorder 266 3.184 1.6

Synonym

Accession P62502 B0QZ80 Q71SF6
Symbols LCN5
hLcn5
UNQ643

Gene

PANTHER Protein Class (1)

 GO Component (1)

 GO Process (1)

Gene RIF (1)

PMID Text
14617364 Predominant expression in the epididymis and location on sperm surface are consistent with a role for LCN6 in male fertility

AA Sequence

MGGLLLAAFLALVSVPRAQAVWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLR      1 - 70
TLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLT     71 - 140
ETASQEAMGLFTKWSRSLGFLSQ                                                   141 - 163
//

Text Mined References (7)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15363845 2004 Molecular evolution of epididymal lipocalin genes localized on mouse chromosome 2.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14617364 2003 LCN6, a novel human epididymal lipocalin.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.