Property Summary

NCBI Gene PubMed Count 6
PubMed Score 11.95
PubTator Score 3.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Bipolar Disorder 666 3.18 1.6

Expression

Gene RIF (1)

AA Sequence

MGGLLLAAFLALVSVPRAQAVWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLR      1 - 70
TLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLT     71 - 140
ETASQEAMGLFTKWSRSLGFLSQ                                                   141 - 163
//

Text Mined References (7)

PMID Year Title