Property Summary

NCBI Gene PubMed Count 50
PubMed Score 53.51
PubTator Score 159.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
acute quadriplegic myopathy 1158 2.3e-06
Multiple myeloma 1332 5.5e-05
ovarian cancer 8520 6.5e-04
diabetes mellitus 1728 4.8e-03
Breast cancer 3578 3.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Chronic purulent otitis media 8 3.776 1.9
Ehrlichiosis 9 3.637 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy 1.426 2.3e-06
Breast cancer 2.100 3.5e-02
diabetes mellitus -1.100 4.8e-03
Multiple myeloma 1.651 5.5e-05
ovarian cancer -1.300 6.5e-04

PDB (19)

Gene RIF (23)

AA Sequence

MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLS      1 - 70
VLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALL     71 - 140
SDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAV    141 - 210
QLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNVKF    211 - 280
IQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQ    281 - 350
EKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQ    351 - 420
GMEYQGGDDEFFDLDDY                                                         421 - 437
//

Text Mined References (61)

PMID Year Title