Property Summary

NCBI Gene PubMed Count 49
Grant Count 5
Funding $99,201.33
PubMed Score 47.96
PubTator Score 159.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.651 0.000
acute quadriplegic myopathy 1.426 0.000
diabetes mellitus -1.100 0.005
Breast cancer 2.100 0.035
ovarian cancer -1.300 0.001

Gene RIF (23)

PMID Text
26655225 New information has been presented on architecture of the eRF1 binding site on mammalian ribosome at various translation termination steps and on conformational rearrangements induced by binding of the release factors.
26245381 cryo-electron microscopy (cryo-EM) structures at 3.5-3.8 A resolution of ribosomal complexes containing eRF1 interacting with each of the three stop codons in the A-site
25735746 We characterized a region of the eRF1 N-terminal domain, the P1 pocket, that we had previously shown to be involved in termination efficiency. We identified two residues, arginine 65 and lysine 109, as critical for recognition of the three stop codons.
24486019 C4 lysyl hydroxylation of eRF1 is required for optimal translational termination
23435318 The role of the 41 invariant and conserved N-domain residues in stop codon decoding by human eRF1 was determined.
23091004 This work provides mechanistic insight into the coordination between GTP hydrolysis by eRF3 and subsequent peptide release by eRF1.
22517631 The NMR data show that the N-domain of human eRF1 exists in two conformational states.
22383581 Authors propose that structural variability in the GTS loop may underline the switching between omnipotency and unipotency of eRF1, implying the direct access of the GTS loop to the stop codon.
21602268 Molecular modeling of eRF1 in the 80S termination complex showed that eRF1 fragments neighboring guanines and adenines of stop signals are compatible with different N domain conformations of eRF1.
20688868 By molecular modeling, the eRF1 molecule can be fitted to the A site proximal to the P-site-bound tRNA and to a stop codon in mRNA via a large conformational change to one of its three domains.
More...

AA Sequence

MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLS      1 - 70
VLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALL     71 - 140
SDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAV    141 - 210
QLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNVKF    211 - 280
IQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQ    281 - 350
EKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQ    351 - 420
GMEYQGGDDEFFDLDDY                                                         421 - 437
//

Text Mined References (59)

PMID Year Title
26655225 2016 Chemical footprinting reveals conformational changes of 18S and 28S rRNAs at different steps of translation termination on the human ribosome.
26245381 2015 Structural basis for stop codon recognition in eukaryotes.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25735746 2015 New insights into stop codon recognition by eRF1.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24486019 2014 Optimal translational termination requires C4 lysyl hydroxylation of eRF1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23435318 2013 Two-step model of stop codon recognition by eukaryotic release factor eRF1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...