Property Summary

NCBI Gene PubMed Count 82
PubMed Score 60.42
PubTator Score 27.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 7.8e-04
Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 5 11 4.662 2.3
Endometriosis of ovary 5 3.012 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.100 7.8e-04

Gene RIF (82)

AA Sequence

MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPV      1 - 70
KYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQD     71 - 140
DEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS                                          141 - 172
//

Text Mined References (84)

PMID Year Title