Property Summary

NCBI Gene PubMed Count 82
PubMed Score 59.38
PubTator Score 27.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung cancer 4473 7.76477452437282E-4
Disease Target Count Z-score Confidence
Endometriosis of ovary 4 3.143 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.100 0.001

Synonym

Accession P62487 B2R5C0 P52433 Q2M1Z4 RNA polymerase II subunit B7
Symbols RPB7
RPB19
hRPB19
hsRPB7

Gene

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD   2C35  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (82)

PMID Text
24359561 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24330569 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24217245 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23827503 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23274668 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23087374 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23073835 The function of Rpb7 interaction with rpb4 in human cells indicate that Rpb7 have gene-specific effects but are also more generally required for human cell survival.
23028129 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
22567366 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
22422068 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
More...

AA Sequence

MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPV      1 - 70
KYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQD     71 - 140
DEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS                                          141 - 172
//

Text Mined References (84)

PMID Year Title
23073835 2012 The RNA Pol II sub-complex hsRpb4/7 is required for viability of multiple human cell lines.
21269460 2011 Initial characterization of the human central proteome.
17848138 2008 Genomic location of the human RNA polymerase II general machinery: evidence for a role of TFIIF and Rpb7 at both early and late stages of transcription.
16327806 2006 RNA emerging from the active site of RNA polymerase II interacts with the Rpb7 subunit.
16282592 2005 Crystal structure and RNA binding of the Rpb4/Rpb7 subunits of human RNA polymerase II.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
12912922 2003 Identification of the RNA polymerase II subunit hsRPB7 as a novel target of the von Hippel-Lindau protein.
More...