Property Summary

NCBI Gene PubMed Count 41
PubMed Score 47.60
PubTator Score 30.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (7)

AA Sequence

MPKGKKAKGKKVAPAPAVVKKQEAKKVVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAIL      1 - 70
YKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGV     71 - 140
NTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTVAFTQVNSE    141 - 210
DKGALAKLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG                  211 - 266
//

Text Mined References (50)

PMID Year Title