Property Summary

NCBI Gene PubMed Count 23
PubMed Score 153.89
PubTator Score 45.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 1.8e-04
astrocytoma -1.200 5.6e-03
ependymoma -1.200 4.6e-08
glioblastoma -1.200 3.6e-04
lung cancer 1.400 2.2e-04
ovarian cancer 1.500 9.0e-04

 GWAS Trait (1)

Gene RIF (11)

AA Sequence

MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTG      1 - 70
ATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCY     71 - 140
RIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEIL                            141 - 186
//

Text Mined References (27)

PMID Year Title