Property Summary

NCBI Gene PubMed Count 21
Grant Count 242
R01 Count 139
Funding $27,187,146.5
PubMed Score 139.23
PubTator Score 45.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.200 0.000
astrocytoma -1.200 0.006
glioblastoma -1.200 0.000
lung cancer 1.400 0.000
adult high grade glioma -1.200 0.000
ovarian cancer 1.500 0.001

Synonym

Accession P62380 A8K8F5 O95753 Q9BWD5 Q9Z2Z0 TBP-like protein 1
Symbols TLF
TLP
STUD
TRF2
MGC:8389
MGC:9620

Gene

PANTHER Protein Class (1)

Gene RIF (9)

PMID Text
26398009 miR18a exhibits a protective role in colorectal cancer (CRC) via inhibiting proliferation, invasion and migration of CRC cells by directly targeting the TBPL1 gene.
24870791 Western blotting and immunohistochemistry both indicated a higher TBPL1 protein expression level in colorectal cancer tissue. siRNA for TBPL1 transfection obviously slowed down the cell proliferation in both SW-620 and HT-29 cells.
24594805 results suggest that activation of the p21 upstream promoter is mediated by interaction between specific regions of TLP and p53
22511763 TLP mediates p53-governed transcriptional activation of the p21 upstream promoter.
19858204 the knockdown of the endogenous TLP reduced etoposide-induced apoptosis through repression of TAp63 expression. Taken together, our present study identifies a TLP-TAp63 pathway that is further implicated in stress-induced apoptosis.
19369647 Observational study of gene-disease association. (HuGE Navigator)
15767669 TLF is a functional regulator of transcription with targets distinct from those of TBP.
15673318 Observational study of gene-disease association. (HuGE Navigator)
15269281 Data show that during interphase, endogenous or exogenously expressed TRF2 is located almost exclusively in the nucleolus

AA Sequence

MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTG      1 - 70
ATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCY     71 - 140
RIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEIL                            141 - 186
//

Text Mined References (25)

PMID Year Title
26398009 2015 Tumor suppressor microRNA-18a regulates tumor proliferation and invasion by targeting TBPL1 in colorectal cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24958592 2014 TRF2, but not TBP, mediates the transcription of ribosomal protein genes.
24870791 2014 MiR-133b acts as a tumor suppressor and negatively regulates TBPL1 in colorectal cancer cells.
24835508 2014 Activity of the upstream TATA-less promoter of the p21(Waf1/Cip1) gene depends on transcription factor IIA (TFIIA) in addition to TFIIA-reactive TBP-like protein.
24594805 2014 Interaction between transactivation domain of p53 and middle part of TBP-like protein (TLP) is involved in TLP-stimulated and p53-activated transcription from the p21 upstream promoter.
22511763 2012 TATA-binding protein (TBP)-like protein is required for p53-dependent transcriptional activation of upstream promoter of p21Waf1/Cip1 gene.
21269460 2011 Initial characterization of the human central proteome.
19858204 2009 TATA-binding Protein (TBP)-like Protein Is Engaged in Etoposide-induced Apoptosis through Transcriptional Activation of Human TAp63 Gene.
19369647 2009 Identification of potentially damaging amino acid substitutions leading to human male infertility.
More...