Property Summary

NCBI Gene PubMed Count 58
PubMed Score 334.78
PubTator Score 21.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2346 3.575 1.8
Vascular disease 281 3.429 1.7

Expression

Gene RIF (29)

PMID Text
26661414 Our results provide evidence on new T1DM-susceptible loci in the PSMA3, PSMA6 and PSMC6 proteasome genes and give a new insight into the T1DM pathogenesis
25801217 Advanced oxidation protein products down-regulate the expression of calcium transport channels through p44/42 MAPK signaling mechanisms in the small intestinal epithelium.
24875235 Evidence of a sex-specific association of PSMC6 genetic variants with subtypes of juvenile idiopathic arthritis.
23125841 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20478047 N protein of SARS Coronavirus interacts with the host cell proteasome subunit p42.
14614829 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14564014 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14557625 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14550573 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14528301 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14528300 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14527406 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12970355 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12920286 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12914693 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12859895 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12840737 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12830140 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12809610 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12808466 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12808465 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12750511 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12719574 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12419264 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12167863 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
10893419 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
9846577 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
9811770 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
9079628 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFI      1 - 70
VKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSE     71 - 140
QIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGE    141 - 210
SARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATN    211 - 280
RPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEA    281 - 350
GMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV                                   351 - 389
//

Text Mined References (65)

PMID Year Title
26661414 2016 Genetic variations in the PSMA3, PSMA6 and PSMC6 genes are associated with type 1 diabetes in Latvians and with expression level of number of UPS-related and T1DM-susceptible genes in HapMap individuals.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25801217 2015 Advanced oxidation protein products decrease the expression of calcium transport channels in small intestinal epithelium via the p44/42 MAPK signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24875235 2014 Juvenile idiopathic arthritis subtype- and sex-specific associations with genetic variants in the PSMA6/PSMC6/PSMA3 gene cluster.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20478047 2010 Interactions of SARS coronavirus nucleocapsid protein with the host cell proteasome subunit p42.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19490896 2009 Assembly pathway of the Mammalian proteasome base subcomplex is mediated by multiple specific chaperones.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
16763564 2006 Roles for APIS and the 20S proteasome in adenovirus E1A-dependent transcription.
16501559 2006 Analysis of the human protein interactome and comparison with yeast, worm and fly interaction datasets.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15831487 2005 Proteasomal ATPase-associated factor 1 negatively regulates proteasome activity by interacting with proteasomal ATPases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614829 2003 The Vif protein of HIV triggers degradation of the human antiretroviral DNA deaminase APOBEC3G.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
14557625 2003 The human immunodeficiency virus type 1 Vif protein reduces intracellular expression and inhibits packaging of APOBEC3G (CEM15), a cellular inhibitor of virus infectivity.
14550573 2003 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits.
14528301 2003 HIV-1 Vif protein binds the editing enzyme APOBEC3G and induces its degradation.
14528300 2003 The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif.
14527406 2003 HIV-1 Vif blocks the antiviral activity of APOBEC3G by impairing both its translation and intracellular stability.
12970355 2003 The enzymatic activity of CEM15/Apobec-3G is essential for the regulation of the infectivity of HIV-1 virion but not a sole determinant of its antiviral activity.
12920286 2003 Virology. Weapons of mutational destruction.
12914693 2003 Death by deamination: a novel host restriction system for HIV-1.
12859895 2003 Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif.
12840737 2003 Good to CU.
12830140 2003 DNA deamination: not just a trigger for antibody diversification but also a mechanism for defense against retroviruses.
12809610 2003 DNA deamination mediates innate immunity to retroviral infection.
12808466 2003 Broad antiretroviral defence by human APOBEC3G through lethal editing of nascent reverse transcripts.
12808465 2003 The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12750511 2003 Hypermutation of HIV-1 DNA in the absence of the Vif protein.
12719574 2003 Comprehensive investigation of the molecular defect in vif-deficient human immunodeficiency virus type 1 virions.
12499840 2002 Neurons and plaques of Alzheimer's disease patients highly express the neuronal membrane docking protein p42IP4/centaurin alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419264 2002 The RTP site shared by the HIV-1 Tat protein and the 11S regulator subunit alpha is crucial for their effects on proteasome function including antigen processing.
12167863 2002 Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein.
11590019 2001 Selective chemical inactivation of AAA proteins reveals distinct functions of proteasomal ATPases.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
10893419 2000 Degradation of HIV-1 integrase by the N-end rule pathway.
10419517 1999 Subcellular localization, stoichiometry, and protein levels of 26 S proteasome subunits in yeast.
10363644 1999 Activator complexes containing the proteasomal regulatory ATPases S10b (SUG2) and S6 (TBP1) in different tissues and organisms.
9846577 1998 Evidence for a newly discovered cellular anti-HIV-1 phenotype.
9811770 1998 An endogenous inhibitor of human immunodeficiency virus in human lymphocytes is overcome by the viral Vif protein.
9473509 1998 Chromosomal localization and immunological analysis of a family of human 26S proteasomal ATPases.
9464850 1997 Purification and characterization of 26S proteasomes from human and mouse spermatozoa.
9079628 1997 HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation.
8811196 1996 Structure and functions of the 20S and 26S proteasomes.
8674546 1996 cDNA cloning of p42, a shared subunit of two proteasome regulatory proteins, reveals a novel member of the AAA protein family.
8621709 1996 Identification, purification, and characterization of a PA700-dependent activator of the proteasome.