Property Summary

NCBI Gene PubMed Count 60
PubMed Score 339.03
PubTator Score 21.49

Knowledge Summary


No data available


  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.577 1.8
Vascular disease 319 3.461 1.7


PDB (22)

Gene RIF (29)

AA Sequence

GMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV                                   351 - 389

Text Mined References (70)

PMID Year Title