Property Summary

NCBI Gene PubMed Count 60
PubMed Score 339.03
PubTator Score 21.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.577 1.8
Vascular disease 319 3.461 1.7

Expression

Gene RIF (29)

AA Sequence

MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFI      1 - 70
VKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSE     71 - 140
QIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGE    141 - 210
SARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATN    211 - 280
RPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEA    281 - 350
GMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV                                   351 - 389
//

Text Mined References (70)

PMID Year Title