Property Summary

NCBI Gene PubMed Count 58
Grant Count 5
R01 Count 5
Funding $234,489.85
PubMed Score 334.78
PubTator Score 21.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 3.575 1.8
Vascular disease 281 3.429 1.7

Expression

Synonym

Accession P62333 B2R975 P49719 Q6IBU3 Q92524
Symbols P44
p42
SUG2
CADP44
HEL-S-73

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR  

Gene RIF (35)

PMID Text
26661414 Our results provide evidence on new T1DM-susceptible loci in the PSMA3, PSMA6 and PSMC6 proteasome genes and give a new insight into the T1DM pathogenesis
25801217 Advanced oxidation protein products down-regulate the expression of calcium transport channels through p44/42 MAPK signaling mechanisms in the small intestinal epithelium.
24875235 Evidence of a sex-specific association of PSMC6 genetic variants with subtypes of juvenile idiopathic arthritis.
23125841 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20478047 N protein of SARS Coronavirus interacts with the host cell proteasome subunit p42.
14614829 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14564014 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
More...

AA Sequence

MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFI      1 - 70
VKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSE     71 - 140
QIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGE    141 - 210
SARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATN    211 - 280
RPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEA    281 - 350
GMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV                                   351 - 389
//

Text Mined References (65)

PMID Year Title
26661414 2016 Genetic variations in the PSMA3, PSMA6 and PSMC6 genes are associated with type 1 diabetes in Latvians and with expression level of number of UPS-related and T1DM-susceptible genes in HapMap individuals.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25801217 2015 Advanced oxidation protein products decrease the expression of calcium transport channels in small intestinal epithelium via the p44/42 MAPK signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24875235 2014 Juvenile idiopathic arthritis subtype- and sex-specific associations with genetic variants in the PSMA6/PSMC6/PSMA3 gene cluster.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...