Property Summary

NCBI Gene PubMed Count 58
PubMed Score 334.78
PubTator Score 21.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Cancer 2346 3.575 1.8
Vascular disease 281 3.429 1.7

Expression

Synonym

Accession P62333 B2R975 P49719 Q6IBU3 Q92524
Symbols P44
p42
SUG2
CADP44
HEL-S-73

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (29)

PMID Text
26661414 Our results provide evidence on new T1DM-susceptible loci in the PSMA3, PSMA6 and PSMC6 proteasome genes and give a new insight into the T1DM pathogenesis
25801217 Advanced oxidation protein products down-regulate the expression of calcium transport channels through p44/42 MAPK signaling mechanisms in the small intestinal epithelium.
24875235 Evidence of a sex-specific association of PSMC6 genetic variants with subtypes of juvenile idiopathic arthritis.
23125841 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20478047 N protein of SARS Coronavirus interacts with the host cell proteasome subunit p42.
14614829 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14564014 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14557625 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14550573 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14528301 Tandem affinity purification and mass spectrometry analysis identify 26S protease regulatory subunit 10B (PSMC6), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
More...

AA Sequence

MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFI      1 - 70
VKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSE     71 - 140
QIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGE    141 - 210
SARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATN    211 - 280
RPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEA    281 - 350
GMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV                                   351 - 389
//

Text Mined References (65)

PMID Year Title
26661414 2016 Genetic variations in the PSMA3, PSMA6 and PSMC6 genes are associated with type 1 diabetes in Latvians and with expression level of number of UPS-related and T1DM-susceptible genes in HapMap individuals.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25801217 2015 Advanced oxidation protein products decrease the expression of calcium transport channels in small intestinal epithelium via the p44/42 MAPK signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24875235 2014 Juvenile idiopathic arthritis subtype- and sex-specific associations with genetic variants in the PSMA6/PSMC6/PSMA3 gene cluster.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...