Property Summary

NCBI Gene PubMed Count 181
PubMed Score 350.72
PubTator Score 273.58

Knowledge Summary


No data available


  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.230 1.2e-07
astrocytoma 1.500 3.0e-02
esophageal adenocarcinoma -1.300 4.1e-02
glioblastoma 1.500 3.4e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.3e-02
juvenile dermatomyositis 1.089 6.0e-09
osteosarcoma 1.529 1.3e-05
ovarian cancer -1.300 6.9e-05
pancreatic cancer 1.300 1.3e-02
psoriasis 1.200 1.0e-04

Protein-protein Interaction (2)

PDB (14)

Gene RIF (144)

AA Sequence

LTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS                                       141 - 175

Text Mined References (196)

PMID Year Title