Property Summary

NCBI Gene PubMed Count 171
Grant Count 246
R01 Count 155
Funding $19,563,040.5
PubMed Score 333.15
PubTator Score 273.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -1.300 0.041
psoriasis 1.200 0.000
osteosarcoma -1.543 0.000
astrocytoma 1.500 0.030
glioblastoma 1.500 0.003
juvenile dermatomyositis 1.089 0.000
acute quadriplegic myopathy 1.230 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.049
ovarian cancer 1.600 0.000
pancreatic cancer 1.300 0.013

Synonym

Accession P62330 P26438 Q6FGZ2
Symbols

Gene

PDB

4KAX   1E0S   2A5D   2A5F   2A5G   2BAO   2BAU   2J5X   2W83   3LVQ   3LVR   3N5C   3PCR   4FME  

Gene RIF (140)

PMID Text
27044891 Mutant p53, which is known to support tumorigenesis via MVP, promotes Arf6 activation.
27031991 The expression of miR-206 by HUVECs reduced exosome production by regulating ADP-Ribosylation Factor 6 (ARF6) and sodium/calcium exchanger 1 (NCX1).
26884337 both Arf6 activation through GluN2B-BRAG1 during early development and the transition from BRAG1- to BRAG2-dependent Arf6 signaling induced by the GluN2 subunit switch are critical for the development of mature glutamatergic synapses.
26503427 results provide evidence for a novel Arf6 activation mechanism by Dyn2 through EFA6B and EFA6D in CME in a manner dependent upon the GTPase activity of Dyn2
26379158 The role of EGFR-ARF6 signaling in BA.
26372645 Data suggest ADAP2 (an interferon-beta stimulated gene) disrupts pathogenic internalization of some RNA viruses/virions (dengue, vesicular stomatitis) by altering ADP ribosylation factor 6-mediated processes including up-regulation of pinocytosis.
26170135 A dominant negative mutant of Arf6 blocks direct transport of APP to lysosomes, but does not affect classical endocytosis to endosomes.
25799492 a role for ARF6 in linking EGF-receptor signaling to Rac1 recruitment and activation at the plasma membrane to promote breast cancer cell directed migration
25779663 Wnt5a is a potential suppressor of EMT; there is a novel Arf6/ERK signaling pathway for EGF-regulated Wnt5a expression at transcriptional level of gastric cancer cel
25773595 Myristoylome profiling reveals a concerted mechanism of ARF GTPase deacylation by the Shigella protease IpaJ.
More...

AA Sequence

MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKI      1 - 70
RPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLG     71 - 140
LTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS                                       141 - 175
//

Text Mined References (186)

PMID Year Title
27044891 2016 P53- and mevalonate pathway-driven malignancies require Arf6 for metastasis and drug resistance.
27031991 2016 Endothelial Cells Can Regulate Smooth Muscle Cells in Contractile Phenotype through the miR-206/ARF6&NCX1/Exosome Axis.
26884337 2016 Subunit-selective N-Methyl-d-aspartate (NMDA) Receptor Signaling through Brefeldin A-resistant Arf Guanine Nucleotide Exchange Factors BRAG1 and BRAG2 during Synapse Maturation.
26503427 2015 Activation of the Small G Protein Arf6 by Dynamin2 through Guanine Nucleotide Exchange Factors in Endocytosis.
26379158 2015 The Role of ARF6 in Biliary Atresia.
26372645 2015 ADAP2 Is an Interferon Stimulated Gene That Restricts RNA Virus Entry.
26170135 2015 Arf6 controls beta-amyloid production by regulating macropinocytosis of the Amyloid Precursor Protein to lysosomes.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25799492 2015 ARF6 promotes the formation of Rac1 and WAVE-dependent ventral F-actin rosettes in breast cancer cells in response to epidermal growth factor.
25779663 2015 EGF-reduced Wnt5a transcription induces epithelial-mesenchymal transition via Arf6-ERK signaling in gastric cancer cells.
More...