Property Summary

NCBI Gene PubMed Count 92
Grant Count 44
R01 Count 21
Funding $3,826,039.08
PubMed Score 487.35
PubTator Score 56.03

Knowledge Summary

Patent

No data available

Expression

Gene RIF (64)

PMID Text
26789270 this study demonstrated, for the first time, that Tbeta4 was down-regulated in ROS-stimulated PDLCs as well as Tbeta4 activation exhibited anti-inflammatory effects and anti-osteoclastogenesis in vitro.
26556858 Tbeta-4 was validated in clinical samples using a tissue microarray to predict overall survival in colon cancer patients
26361868 this study demonstrates, for the first time, that Tbeta4 is expressed in developing periodontal tissue and that its expression is associated with osteoblastic/cementoblastic differentiation.
26276576 Overexpression of Tbeta4 enhanced cell proliferation and colony formation in oral squamous cell carcinoma.
26006229 This article reviews the potential role of thymosin beta 4 in liver fibrosis by describing the effects of exogenous and endogenous thymosin beta 4 , and discusses the possible signaling pathway regulated by TB4X. [review]
25695679 The results of the present study suggested that Tb4 may promote HB metastasis via the induction of EMT, and that Tb4 may therefore be a target for the development of novel treatments for patients with Hepatoblastoma .
25313062 the exchange of bound actin between Tbeta4 and profilin involves both steric and allosteric components.
25271630 these results suggest that NO could regulate the expression of Tbeta4 by direct or indirect effect of HIF-1alpha on Tbeta4 promoter.
25218472 Thymosin beta4 induces invasion and migration of human colorectal cancer cells through the ILK/AKT/beta-catenin signaling pathway.
24704991 Regarding HCC, Tbeta4 reactivity was detected in 7/23 cases (30%) and Tbeta10 reactivity in 22/23 (97%) cases analyzed, adding HCC to human cancers that express these beta-thymosins.
More...

AA Sequence

MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES                                1 - 44
//

Text Mined References (101)

PMID Year Title
26789270 2016 Thymosin Beta-4 Suppresses Osteoclastic Differentiation and Inflammatory Responses in Human Periodontal Ligament Cells.
26556858 2015 MALDI-imaging reveals thymosin beta-4 as an independent prognostic marker for colorectal cancer.
26361868 Expression of thymosin beta-4 in human periodontal ligament cells and mouse periodontal tissue and its role in osteoblastic/cementoblastic differentiation.
26276576 2016 Thymosin ?4 induces proliferation, invasion, and epithelial-to-mesenchymal transition of oral squamous cell carcinoma.
26006229 2015 Potential role of thymosin Beta 4 in liver fibrosis.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25695679 2015 Thymosin ?4 promotes hepatoblastoma metastasis via the induction of epithelial-mesenchymal transition.
25313062 2014 Structural basis of thymosin-?4/profilin exchange leading to actin filament polymerization.
25271630 2014 The actin-sequestering protein thymosin beta-4 is a novel target of hypoxia-inducible nitric oxide and HIF-1? regulation.
25218472 2014 Thymosin ?4 induces invasion and migration of human colorectal cancer cells through the ILK/AKT/?-catenin signaling pathway.
More...