Property Summary

NCBI Gene PubMed Count 100
PubMed Score 511.81
PubTator Score 56.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
AMYOTROPHIC LATERAL SCLEROSIS 1 49 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count Z-score Confidence
Celiac disease 116 0.0 2.9
Disease Target Count Z-score Confidence
Myocardial Infarction 151 3.871 1.9
Cancer 2499 3.318 1.7
Nezelof syndrome 4 3.217 1.6

Expression

 GWAS Trait (1)

Gene RIF (69)

AA Sequence

MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES                                1 - 44
//

Text Mined References (110)

PMID Year Title