Property Summary

NCBI Gene PubMed Count 47
PubMed Score 1.00
PubTator Score 51.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Multiple myeloma 1.556 1.1e-02
acute quadriplegic myopathy 2.025 1.2e-05
Amyotrophic lateral sclerosis 1.092 3.7e-04
astrocytoma 1.300 1.2e-25
autosomal dominant Emery-Dreifuss muscul... 1.642 4.1e-03
dermatomyositis 1.800 8.9e-05
diabetes mellitus -1.200 2.3e-02
Duchenne muscular dystrophy 1.214 1.4e-04
glioblastoma 2.600 1.6e-04
group 4 medulloblastoma 1.100 3.2e-02
juvenile dermatomyositis 1.523 4.6e-10
limb girdle muscular dystrophy 2I 1.105 7.2e-03
lung adenocarcinoma -1.500 1.0e-11
malignant mesothelioma -1.800 5.5e-07
oligodendroglioma 1.500 3.1e-16
osteosarcoma 1.957 7.7e-06
ovarian cancer -1.800 4.2e-06
Pick disease 1.300 2.1e-04
primitive neuroectodermal tumor 1.400 7.9e-03

Gene RIF (29)

AA Sequence

MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCI      1 - 70
RINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNV     71 - 140
QMVDSRISCKEELLLGRTSPSKNYNMMTVSG                                           141 - 171
//

Text Mined References (48)

PMID Year Title