Property Summary

NCBI Gene PubMed Count 44
Grant Count 6
R01 Count 4
Funding $214,106.72
PubMed Score 0.92
PubTator Score 51.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Multiple myeloma 1.556 0.011
malignant mesothelioma -1.800 0.000
astrocytoma 1.900 0.001
glioblastoma 2.600 0.000
oligodendroglioma 1.500 0.000
osteosarcoma 1.957 0.000
medulloblastoma 1.200 0.001
primitive neuroectodermal tumor 1.400 0.008
Duchenne muscular dystrophy 1.796 0.000
limb girdle muscular dystrophy 2I 1.105 0.007
autosomal dominant Emery-Dreifuss muscul... 1.754 0.003
juvenile dermatomyositis 2.063 0.000
Amyotrophic Lateral Sclerosis 1.204 0.000
acute quadriplegic myopathy 2.025 0.000
diabetes mellitus -1.200 0.023
lung adenocarcinoma -1.500 0.000
Pick disease 1.300 0.000
ovarian cancer 2.700 0.000
dermatomyositis 1.800 0.000

Gene RIF (26)

PMID Text
26503430 our data suggest that BTG1 overexpression combined with radiation therapy increases the therapeutic efficacy of breast cancer treatment via regulation of the cell cycle and apoptosis-related signaling pathways.
26050197 Suggest that down-regulated BTG1 expression might promote gastric carcinogenesis partially due to its promoter methylation. BTG1 overexpression might reverse the aggressive phenotypes.
25936765 Data indicate that microRNA-19a regulates prostate cancer cells by directly targeting B cell translocation gene-1 protein BTG1.
25487193 Altered expression of BTG1 is a potential biomarker for carcinogenesis and progression of gastric cancer, particularly for proximal nondiffuse and diffuse GC.
25405901 Our results indicate that altered BTG1 expression might affect hepatocarcinogenesis and may represent a novel biomarker for HCC carcinogenesis and progression.
25173640 BTG1 protein levels were significantly reduced in hepatocellular cancer and were associated with lymph node metastasis, clinical stage, cell differentiation, and prognosis.
25115181 Down-regulation of BTG1 by miR-454-3p renders tumor cells sensitive to radiation.
25017022 Results show that reduced BTG1 expression is associated with increased disease severity, suggesting it as negative regulator of thyroid cancer.
24998463 BTG1 deletions might play a role in leukemogenesis of B-cell precursor acute lymphoblastic leukemia as well as of BCR-ABL1-positive mixed-phenotype acute leukemia and chronic myeloid leukemia in B-lineage blast crisis (B-lineage).
24985971 Reduced BTG1 expression is associated with increased nasopharyngeal cancer severity, suggesting it is a negative regulator of the cancer and can serve as a prognostic indicator. Reduced BTG1 expression is possibly associated with tumour metastasis.
More...

AA Sequence

MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCI      1 - 70
RINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNV     71 - 140
QMVDSRISCKEELLLGRTSPSKNYNMMTVSG                                           141 - 171
//

Text Mined References (45)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26503430 2015 Upregulation of BTG1 enhances the radiation sensitivity of human breast cancer in vitro and in vivo.
26050197 2015 BTG1 expression correlates with pathogenesis, aggressive behaviors and prognosis of gastric cancer: a potential target for gene therapy.
25936765 2015 MicroRNA-19a regulates proliferation and apoptosis of castration-resistant prostate cancer cells by targeting BTG1.
25487193 2015 Diversity of clinical implication of B-cell translocation gene 1 expression by histopathologic and anatomic subtypes of gastric cancer.
25405901 2015 B?cell translocation gene 1 serves as a novel prognostic indicator of hepatocellular carcinoma.
25173640 2014 Expression of BTG1 in hepatocellular carcinoma and its correlation with cell cycles, cell apoptosis, and cell metastasis.
25115181 2014 Down-regulation of BTG1 by miR-454-3p enhances cellular radiosensitivity in renal carcinoma cells.
25017022 2014 BTG1 expression in thyroid carcinoma: diagnostic indicator and prognostic marker.
24998463 2014 High frequency of BTG1 deletions in patients with BCR-ABL1-positive acute leukemia.
More...