Property Summary

NCBI Gene PubMed Count 53
Grant Count 10
R01 Count 5
Funding $1,133,622.75
PubMed Score 33.22
PubTator Score 18.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.628 0.002
Multiple myeloma 1.062 0.013
lung cancer 1.200 0.029
group 3 medulloblastoma 1.200 0.000
ovarian cancer 1.700 0.001
dermatomyositis 1.100 0.000

Gene RIF (3)

PMID Text
18854154 Knockdown of small nuclear ribonucleoprotein D3 polypeptide (SNRPD3, 18kDa) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
15642139 The dimethylated arginine residues play an essential role in the formation of major SmD3 autoepitopes. 1 particular peptide of SmD3 represents a more sensitive and more reliable substrate for the detection of a subclass of anti-Sm antibodies.
11780068 U2 snRNPs interact with the HIV-1 Tat cofactor TAT-SF1 and stimulate transcription from the HIV-1 LTR promoter

AA Sequence

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRF      1 - 70
LILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR                   71 - 126
//

Text Mined References (60)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21874759 2011 Sm peptides in differentiation of autoimmune diseases.
21516107 2011 Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
21269460 2011 Initial characterization of the human central proteome.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
More...