Property Summary

NCBI Gene PubMed Count 42
Grant Count 2
Funding $154,500
PubMed Score 39.07
PubTator Score 18.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.093 0.039
Multiple myeloma 1.212 0.010
lung cancer 2.000 0.000
diabetes mellitus -1.100 0.001
sonic hedgehog group medulloblastoma 1.300 0.000
ovarian cancer -1.100 0.004

Synonym

Accession P62316 A8K797 J3KPM5 P43330 Sm-D2
Symbols SMD2
Sm-D2
SNRPD1

Gene

 Grant Application (2)

PDB

3JCR   1B34   3CW1   3PGW   3S6N   4F7U   4PJO   4V98   4WZJ  

 GO Function (1)

Gene RIF (1)

PMID Text
11780068 U2 snRNPs interact with the HIV-1 Tat cofactor TAT-SF1 and stimulate transcription from the HIV-1 LTR promoter

AA Sequence

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENV      1 - 70
KEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK                           71 - 118
//

Text Mined References (52)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23333303 2013 Structural basis of assembly chaperone- mediated snRNP formation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
More...