Property Summary

NCBI Gene PubMed Count 42
PubMed Score 39.07
PubTator Score 18.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 1.25254434441326E-6
lung cancer 4473 2.77771087879183E-5
diabetes mellitus 1663 0.00116587787889355
ovarian cancer 8492 0.00412042810308041
Multiple myeloma 1328 0.01007553806524
Waldenstrons macroglobulinemia 765 0.0390890639971595

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.093 0.039
Multiple myeloma 1.212 0.010
lung cancer 2.000 0.000
diabetes mellitus -1.100 0.001
sonic hedgehog group medulloblastoma 1.300 0.000
ovarian cancer -1.100 0.004

Synonym

Accession P62316 A8K797 J3KPM5 P43330 Sm-D2
Symbols SMD2
Sm-D2
SNRPD1

Gene

PDB

3JCR   1B34   3CW1   3PGW   3S6N   4F7U   4PJO   4V98   4WZJ  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (1)

PMID Text
11780068 U2 snRNPs interact with the HIV-1 Tat cofactor TAT-SF1 and stimulate transcription from the HIV-1 LTR promoter

AA Sequence

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENV      1 - 70
KEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK                           71 - 118
//

Text Mined References (52)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23333303 2013 Structural basis of assembly chaperone- mediated snRNP formation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
More...