Property Summary

NCBI Gene PubMed Count 48
PubMed Score 208.69
PubTator Score 77.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 9.52360404106205E-16
atypical teratoid/rhabdoid tumor 1095 2.83843960600523E-5
sonic hedgehog group medulloblastoma 1482 2.9038254245187E-5
lung cancer 4473 3.65765314354109E-5
medulloblastoma, large-cell 6234 9.81804733052158E-5
Multiple myeloma 1328 3.11473873798624E-4
ovarian cancer 8492 5.29596253088234E-4
psoriasis 6685 0.00146356865339909
dermatomyositis 967 0.00275789896736316
Pneumonia 133 0.00497947131234344
Polycystic Ovary Syndrome 335 0.00572552626186823
acute myeloid leukemia 785 0.0295770928385356
gastric carcinoma 832 0.0465074345993622

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.277 0.000
psoriasis 1.100 0.001
sonic hedgehog group medulloblastoma 1.600 0.000
medulloblastoma, large-cell 1.400 0.000
non-small cell lung cancer 1.138 0.000
lung cancer 2.300 0.000
atypical teratoid/rhabdoid tumor 1.100 0.000
Pneumonia -1.500 0.005
Polycystic Ovary Syndrome 1.151 0.006
gastric carcinoma 1.100 0.047
acute myeloid leukemia -1.400 0.030
ovarian cancer 1.800 0.001
dermatomyositis 1.400 0.003

Synonym

Accession P62314 B5BTZ1 P13641 Sm-D1
Symbols SMD1
SNRPD
Sm-D1
HsT2456

Gene

PDB

3JCR   1B34   3CW1   3PGW   3S6N   4F7U   4PJO   4V98   4WZJ  

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (4)

PMID Text
25273532 Data show that the elevation of cerebrospinal fluid anti-Sm antibodies through transudation from systemic circulation due to damaged blood-brain barrier (BBB) plays a critical role in the pathogenesis of acute confusional state (ACS).
24413165 The interaction of SMN with the spliceosomal SmD1 (also known as SNRPD1), severely decreases SMN-coilin interaction and prevents Cajal body assembly.
23358685 Overexpression of SNRPD1 is associated with highly aggressive breast cancers.
11780068 U2 snRNPs interact with the HIV-1 Tat cofactor TAT-SF1 and stimulate transcription from the HIV-1 LTR promoter

AA Sequence

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL      1 - 70
PDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR                          71 - 119
//

Text Mined References (53)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25273532 2014 Association of cerebrospinal fluid anti-Sm antibodies with acute confusional state in systemic lupus erythematosus.
24413165 2014 The SMN Tudor SIM-like domain is key to SmD1 and coilin interactions and to Cajal body biogenesis.
23358685 2013 Targeting the deregulated spliceosome core machinery in cancer cells triggers mTOR blockade and autophagy.
23333303 2013 Structural basis of assembly chaperone- mediated snRNP formation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...