Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.65
PubTator Score 3.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 2.96630110687852E-6
subependymal giant cell astrocytoma 2287 0.0108893316347577
acute myeloid leukemia 785 0.0474579383848535
Disease Target Count Z-score Confidence
interleukin-7 receptor alpha deficiency 16 3.552 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
subependymal giant cell astrocytoma -1.098 0.011
acute myeloid leukemia -1.600 0.047

Synonym

Accession P62312 Q4W5J5 Q9Y4Y8
Symbols YDR378C

Gene

PDB

3JCR  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci

AA Sequence

MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV      1 - 70
LYISTQKRRM                                                                 71 - 80
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12515382 2002 The human LSm1-7 proteins colocalize with the mRNA-degrading enzymes Dcp1/2 and Xrnl in distinct cytoplasmic foci.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11920408 2002 Autoantibody to hLSm4 and the heptameric LSm complex in anti-Sm sera.
10851237 2000 Specific sequences of the Sm and Sm-like (Lsm) proteins mediate their interaction with the spinal muscular atrophy disease gene product (SMN).
10523320 1999 A doughnut-shaped heteromer of human Sm-like proteins binds to the 3'-end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro.
10369684 1999 Sm and Sm-like proteins assemble in two related complexes of deep evolutionary origin.