Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.73
PubTator Score 3.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.600 4.7e-02
malignant mesothelioma 1.200 3.0e-06
subependymal giant cell astrocytoma -1.098 1.1e-02

 GO Function (1)

Gene RIF (1)

AA Sequence

MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV      1 - 70
LYISTQKRRM                                                                 71 - 80
//

Text Mined References (17)

PMID Year Title