Property Summary

NCBI Gene PubMed Count 24
PubMed Score 5.44
PubTator Score 3.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 9.8e-07
breast carcinoma 1.300 3.5e-03
glioblastoma -1.100 1.8e-03
group 3 medulloblastoma 1.200 3.5e-03
lung cancer 1.100 4.3e-04
osteosarcoma -1.702 7.4e-07
ovarian cancer 1.200 9.0e-04

 GO Function (1)

Gene RIF (2)

AA Sequence

MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEET      1 - 70
YEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG                                           71 - 102
//

Text Mined References (28)

PMID Year Title