Property Summary

NCBI Gene PubMed Count 22
PubMed Score 5.40
PubTator Score 3.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 7.43657443930023E-7
atypical teratoid / rhabdoid tumor 4369 9.78262407964392E-7
lung cancer 4473 4.27482134194761E-4
ovarian cancer 8492 9.04417875963401E-4
glioblastoma 5572 0.00184978123038173
group 3 medulloblastoma 2254 0.00352764039645513
breast carcinoma 1614 0.00353304038800518

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.702 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.100 0.002
lung cancer 1.100 0.000
breast carcinoma 1.300 0.004
group 3 medulloblastoma 1.200 0.004
ovarian cancer 1.200 0.001

Synonym

Accession P62310 Q6IAH0 Q9Y4Z1
Symbols SMX4
USS2
YLR438C

Gene

PDB

3JCR  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
18187620 Knockdown of LSM3 homolog, U6 small nuclear RNA associated (LSM3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci

AA Sequence

MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEET      1 - 70
YEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG                                           71 - 102
//

Text Mined References (26)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23986595 2013 A host YB-1 ribonucleoprotein complex is hijacked by hepatitis C virus for the control of NS3-dependent particle production.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...