Property Summary

NCBI Gene PubMed Count 33
PubMed Score 1.33
PubTator Score 42.93

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (1)

PMID Text
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein polypeptide G (SNRPG), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SNRPG is increased by RRE

AA Sequence

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML      1 - 70
EALERV                                                                     71 - 76
//

Text Mined References (36)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23333303 2013 Structural basis of assembly chaperone- mediated snRNP formation.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21816274 2011 Structure of a key intermediate of the SMN complex reveals Gemin2's crucial function in snRNP assembly.
21516107 2011 Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
19928837 2010 The SMN interactome includes Myb-binding protein 1a.
19325628 2009 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
More...