Property Summary

NCBI Gene PubMed Count 33
PubMed Score 1.33
PubTator Score 42.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Adenocarcinoma of lung 142 0.0 0.0
Disease Models, Animal 155 0.0 0.0

Expression

 GO Function (1)

Gene RIF (1)

AA Sequence

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML      1 - 70
EALERV                                                                     71 - 76
//

Text Mined References (36)

PMID Year Title