Property Summary

NCBI Gene PubMed Count 41
PubMed Score 540.77
PubTator Score 35.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

Synonym

Accession P62304 B2R5B9 P08578 Q15498 Q5BKT2 snRNP-E
Symbols SME
Sm-E
HYPT11
snRNP-E

Gene

PDB

3JCR   3CW1   3PGW   3S6N   4F7U   4PJO   4V98   4WZJ  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (5)

PMID Text
23358685 Overexpression of SNRPE is associated with highly aggressive breast cancers.
23246290 Mutations in SNRPE, which encodes a core protein of the spliceosome, cause autosomal-dominant hypotrichosis simplex
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein polypeptide E (SNRPE), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SNRPE is increased by RRE
18208561 growth arrest by SmE directly correlates with the reduction of cyclin E, CDK2, CDC25C and CDC2 expression, and up-regulation of p27Kip
12022225 In the SME intron, the position of the branchpoint A residue within the region base paired with U12 differs from that in P120 and XTF.

AA Sequence

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKS      1 - 70
RKQLGRIMLKGDNITLLQSVSN                                                     71 - 92
//

Text Mined References (46)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23358685 2013 Targeting the deregulated spliceosome core machinery in cancer cells triggers mTOR blockade and autophagy.
23333303 2013 Structural basis of assembly chaperone- mediated snRNP formation.
23246290 2013 Mutations in SNRPE, which encodes a core protein of the spliceosome, cause autosomal-dominant hypotrichosis simplex.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21516107 2011 Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
21269460 2011 Initial characterization of the human central proteome.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
19325628 2009 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.
More...