Property Summary

NCBI Gene PubMed Count 41
Grant Count 23
R01 Count 10
Funding $2,952,976.9
PubMed Score 540.77
PubTator Score 35.87

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (5)

PMID Text
23358685 Overexpression of SNRPE is associated with highly aggressive breast cancers.
23246290 Mutations in SNRPE, which encodes a core protein of the spliceosome, cause autosomal-dominant hypotrichosis simplex
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein polypeptide E (SNRPE), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SNRPE is increased by RRE
18208561 growth arrest by SmE directly correlates with the reduction of cyclin E, CDK2, CDC25C and CDC2 expression, and up-regulation of p27Kip
12022225 In the SME intron, the position of the branchpoint A residue within the region base paired with U12 differs from that in P120 and XTF.

AA Sequence

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKS      1 - 70
RKQLGRIMLKGDNITLLQSVSN                                                     71 - 92
//

Text Mined References (46)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23358685 2013 Targeting the deregulated spliceosome core machinery in cancer cells triggers mTOR blockade and autophagy.
23333303 2013 Structural basis of assembly chaperone- mediated snRNP formation.
23246290 2013 Mutations in SNRPE, which encodes a core protein of the spliceosome, cause autosomal-dominant hypotrichosis simplex.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21516107 2011 Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
21269460 2011 Initial characterization of the human central proteome.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
19325628 2009 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.
More...