Property Summary

NCBI Gene PubMed Count 28
Grant Count 10
R01 Count 8
Funding $734,959.75
PubMed Score 22.71
PubTator Score 7.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.218 0.002
lung cancer -3.400 0.041
diabetes mellitus -1.400 0.002
sonic hedgehog group medulloblastoma 1.100 0.000

Gene RIF (1)

PMID Text
26506620 increased expression of RPS11 and RPS20 predicts shorter patient survival. treatment-resistant GSC clones are clinically relevant cells that represent resistant tumorigenic clones from patient tumors and that their properties

AA Sequence

MADIQTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRG      1 - 70
RILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRF     71 - 140
NVLKVTKAAGTKKQFQKF                                                        141 - 158
//

Text Mined References (39)

PMID Year Title
26506620 2015 Ribosomal Proteins RPS11 and RPS20, Two Stress-Response Markers of Glioblastoma Stem Cells, Are Novel Predictors of Poor Prognosis in Glioblastoma Patients.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...