Property Summary

NCBI Gene PubMed Count 32
Grant Count 38
R01 Count 23
Funding $11,190,643.64
PubMed Score 375.64
PubTator Score 78.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 3.694 1.8
diabetes mellitus 1,663

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.700 0.003

Gene RIF (6)

PMID Text
22295575 binding of ribosomal protein S13 to 18S rRNA is provided mainly by conserved motifs of the protein corresponding to those motifs in its eubacterial homologue that are involved in the interaction with 16S rRNA in the 30S subunit.
19912438 these data indicate that RPS13 could promote the growth and cell cycle progression of gastric cancer cells at least through inhibiting p27(kip1) expression.
17881366 Overproduction of rpS13 in mammalian cells interferes with splicing of its own pre-mRNA by a feedback mechanism.
15680243 Recombinant ribosomal protein S13 expressed in and isolated from E.coli was shown to be suitable for structural and functional investigations.
15149863 either RPS13 or RPL23 can promote MDR in gastric cancer cells by suppressing drug-induced apoptosis, and RPL23 may also promote MDR in gastric cancer cells through regulation of glutathione S-transferase-mediated drug-detoxifying system
12861018 S13 subunit may possess multiple functions, including a deubiquitinylating activity and distinct activities essential for cell cycle progression that require the conserved C120 residue

AA Sequence

MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNK      1 - 70
ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWK     71 - 140
YESSTASALVA                                                               141 - 151
//

Text Mined References (40)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25854864 2015 Interaction between human BAP31 and respiratory syncytial virus small hydrophobic (SH) protein.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22295575 [Binding of human ribosomal protein S13 to the central domain of 18S rRNA].
More...