Property Summary

NCBI Gene PubMed Count 33
PubMed Score 393.60
PubTator Score 78.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.3e-03
Disease Target Count Z-score Confidence
Cancer 2499 3.765 1.9
Hereditary spherocytosis 16 3.082 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.600 1.3e-03

Gene RIF (6)

AA Sequence

MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNK      1 - 70
ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWK     71 - 140
YESSTASALVA                                                               141 - 151
//

Text Mined References (43)

PMID Year Title