Property Summary

NCBI Gene PubMed Count 29
Grant Count 1
Funding $60,475.75
PubMed Score 41.93
PubTator Score 28.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession P62269 P25232 Q5SUJ3 Q6IPF8
Symbols KE3
S18
HKE3
KE-3
D6S218E

Gene

 Grant Application (1)

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

 MGI Term (1)

Gene RIF (4)

PMID Text
21256985 Ribosomal protein S18e seems to act as a molecular staple fixing the 18S rRNA 3'-major domain core.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
15532723 cofilin interacts with S18 protein at the actin-binding site

AA Sequence

MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITI      1 - 70
MQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTG     71 - 140
RRGRTVGVSKKK                                                              141 - 152
//

Text Mined References (37)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...