Property Summary

NCBI Gene PubMed Count 29
PubMed Score 45.83
PubTator Score 28.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITI      1 - 70
MQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTG     71 - 140
RRGRTVGVSKKK                                                              141 - 152
//

Text Mined References (39)

PMID Year Title