Property Summary

NCBI Gene PubMed Count 46
Grant Count 44
R01 Count 28
Funding $3,332,246.09
PubMed Score 152.61
PubTator Score 133.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
inflammatory breast cancer -1.100 0.002
ovarian cancer -1.200 0.000

Gene RIF (16)

PMID Text
24074450 Partial silencing of RPS14 inhibits the proliferation of SKM-1, an acute myeloid leukemia cell line, and RPS14 negatively regulates p53 activation in SKM-1 cells.
23943650 Patients with nonclassical Diamond Blackfan anemia and other hypoproliferative anemias may have somatically acquired 5q deletions with RPS14 haploinsufficiency
23775087 Data indicate that RPS14 negates c-Myc functions by directly inhibiting its transcriptional activity and mediating its mRNA degradation via miRNA.
23506134 lower RPS14 predicts prolonged survival and possible response to lenalidomide in lower risk MDS patients.
23246961 RPS14 stabilized and activated p53 by inhibiting HDM2-mediated p53 polyubiquitination and degradation
22430631 Loss of RPS14 is associated with 5q-syndrome.
22391559 RPS14 and RPS19 have distinct roles in regulating the MDM2-p53 feedback loop in response to ribosomal stress
21873545 Combined loss of miR-145 and RPS14 cooperates to alter erythroid-megakaryocytic differentiation in a manner similar to the 5q- syndrome.
21068437 p53 accumulates selectively in the erythroid lineage in primary human hematopoietic progenitor cells after expression of shRNAs targeting RPS14, the ribosomal protein gene deleted in the 5q-syndrome, or RPS19.
20877624 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESS      1 - 70
PYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDST     71 - 140
RRKGGRRGRRL                                                               141 - 151
//

Text Mined References (57)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24074450 2014 Ribosomal protein S14 silencing inhibits growth of acute myeloid leukemia transformed from myelodysplastic syndromes via activating p53.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23943650 2013 Diminutive somatic deletions in the 5q region lead to a phenotype atypical of classical 5q- syndrome.
23775087 2013 Ribosomal protein S14 negatively regulates c-Myc activity.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23506134 2013 Low RPS14 expression in MDS without 5q - aberration confers higher apoptosis rate of nucleated erythrocytes and predicts prolonged survival and possible response to lenalidomide in lower risk non-5q- patients.
More...