Property Summary

NCBI Gene PubMed Count 199
PubMed Score 170.51
PubTator Score 101.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Neoplasm Metastasis 168 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.4e-02
dermatomyositis -2.700 2.4e-03
Down syndrome 1.900 7.1e-03
ependymoma 1.400 2.0e-02
group 4 medulloblastoma 1.500 4.4e-02
hereditary spastic paraplegia -1.769 8.4e-03
interstitial cystitis -1.400 7.3e-03
medulloblastoma, large-cell 1.600 3.1e-03
Multiple myeloma 1.234 4.4e-04
oligodendroglioma 1.200 3.6e-03
osteosarcoma 2.401 1.9e-06
ovarian cancer -1.200 1.4e-06
Pick disease -1.700 1.6e-05
psoriasis -2.000 1.2e-04
Rheumatoid arthritis -2.400 4.4e-03

Protein-protein Interaction (1)

Gene RIF (79)

AA Sequence

MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE      1 - 70
ENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGND     71 - 140
RKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLS    141 - 210
EESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ                             211 - 255
//

Text Mined References (214)

PMID Year Title