Property Summary

NCBI Gene PubMed Count 186
Grant Count 33
R01 Count 28
Funding $5,044,040.1
PubMed Score 158.61
PubTator Score 101.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis -2.400 0.004
Multiple myeloma 1.234 0.000
ependymoma 1.400 0.020
oligodendroglioma 1.200 0.004
psoriasis -2.000 0.000
osteosarcoma 2.401 0.000
atypical teratoid / rhabdoid tumor 1.200 0.024
group 4 medulloblastoma 1.500 0.044
medulloblastoma, large-cell 1.600 0.003
hereditary spastic paraplegia -1.769 0.008
interstitial cystitis -1.400 0.007
Pick disease -1.700 0.000
ovarian cancer 1.400 0.004
Down syndrome 1.900 0.007
dermatomyositis -2.700 0.002

 GWAS Trait (1)

Gene RIF (77)

PMID Text
27000436 Report mutually exclusive BCOR internal tandem duplications and YWHAE-NUTM2 fusions in clear cell sarcoma of kidney.
26998762 Data show that the NS3 protein of dengue virus bound to 14-3-3 epsilon protein (14-3-3varepsilon) and prevented translocation of retinoic acid-inducible gene-I protein (RIG-I) to the adaptor MAVS protein and thereby blocked antiviral signaling.
26616734 CEP131 is the key regulatory target of MK2 and 14-3-3 in centriolar satellite remodeling.
26542179 Studies show that patients with clear cell sarcoma of the kidney (CCSK) and the fusion YWHAE-NUTM2B/E were relatively young, had low tumor volumes, and did not present with stage I disease which fail to identify an explicit clinical phenotype.
26208633 14-3-3epsilon might directly bind to CD13, which transmits its signal in chondrocytes to induce a catabolic phenotype similar to that observed in osteoarthritis.
26047703 DAPK2-induced apoptosis is negatively regulated by Akt and 14-3-3 proteins.
25770209 These data demonstrate a novel role for HDAC6 in controlling 14-3-3zeta binding activity.
25244606 YWHAE-FAM22 rearrangement is associated with endometrial stromal sarcomas.
25154416 Data show that two isoforms of the 14-3-3 family, 14-3-3epsilon and 14-3-3 gamma, can stabilize Cdt2 independent of each other when overexpressed.
25105667 Results suggest a specific role for YWHAE single nucleotide polymorphisms in the pathophysiology of schizophrenia.
More...

AA Sequence

MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE      1 - 70
ENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGND     71 - 140
RKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLS    141 - 210
EESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ                             211 - 255
//

Text Mined References (202)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27000436 2016 Mutually exclusive BCOR internal tandem duplications and YWHAE-NUTM2 fusions in clear cell sarcoma of kidney: not the full story.
26998762 2016 A phosphomimetic-based mechanism of dengue virus to antagonize innate immunity.
26616734 2015 p38- and MK2-dependent signalling promotes stress-induced centriolar satellite remodelling via 14-3-3-dependent sequestration of CEP131/AZI1.
26542179 2016 The clinical phenotype of YWHAE-NUTM2B/E positive pediatric clear cell sarcoma of the kidney.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26208633 2015 The pro-inflammatory cytokine 14-3-3? is a ligand of CD13 in cartilage.
26055712 2015 Phosphorylation-dependent Regulation of Connecdenn/DENND1 Guanine Nucleotide Exchange Factors.
26047703 2015 Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
More...