Property Summary

NCBI Gene PubMed Count 19
Grant Count 5
R01 Count 5
Funding $594,475
PubMed Score 18.73
PubTator Score 14.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
esophageal adenocarcinoma -1.100 0.025
psoriasis 1.600 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.400 0.000
juvenile dermatomyositis 1.259 0.000
non-small cell lung cancer 1.279 0.000
lung cancer 1.100 0.009
adult high grade glioma -1.700 0.000
non primary Sjogren syndrome sicca 1.200 0.013
spina bifida -1.567 0.039
ovarian cancer 3.100 0.000
pancreatic cancer 1.400 0.049

Synonym

Accession P62256 A4D1L6 C9JY93 P37286 Q7Z6F4
Symbols GID3
UBC8
UBCH
UBCH2
E2-20K

Gene

PDB

2Z5D  

Gene RIF (6)

PMID Text
20028976 Tal1 expression activated UBE2H expression, whereas Tal1 knock-down reduced UBE2H expression and ubiquitin transfer activity.
19922136 Results suggest that the UBE2H gene is not implicated in sporadic ALS.
19922136 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of ubiquitin-conjugating enzyme E2H (UBE2H) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
14639049 UBE2H gene could be one of the 7q-susceptibility loci for autistic disorder.

AA Sequence

MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGF      1 - 70
MNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQK     71 - 140
IKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL                               141 - 183
//

Text Mined References (21)

PMID Year Title
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
21269460 2011 Initial characterization of the human central proteome.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
20028976 2010 Targets of the Tal1 transcription factor in erythrocytes: E2 ubiquitin conjugase regulation by Tal1.
19922136 Association study of the ubiquitin conjugating enzyme gene UBE2H in sporadic ALS.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17588522 2007 E3-independent monoubiquitination of ubiquitin-binding proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...