Property Summary

NCBI Gene PubMed Count 19
PubMed Score 18.70
PubTator Score 14.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.700 3.1e-04
esophageal adenocarcinoma -1.100 2.5e-02
glioblastoma 1.200 3.6e-02
juvenile dermatomyositis 1.259 9.1e-08
lung cancer 1.100 9.4e-03
malignant mesothelioma -1.800 2.7e-06
medulloblastoma, large-cell -1.400 9.8e-05
non primary Sjogren syndrome sicca 1.200 1.3e-02
non-small cell lung cancer 1.279 7.9e-16
ovarian cancer 1.400 5.1e-06
pancreatic cancer 1.400 4.9e-02
psoriasis 1.500 1.4e-10
spina bifida 1.043 3.0e-02

 MGI Phenotype (1)

Gene RIF (6)

AA Sequence

MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGF      1 - 70
MNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQK     71 - 140
IKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL                               141 - 183
//

Text Mined References (22)

PMID Year Title