Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.55
PubTator Score 3.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession P62253 B2R7P2 D3DTK0 Q99462
Symbols UBC7
E217K
UBE2G

Gene

PDB

2AWF  

Gene RIF (3)

PMID Text
25471371 ubiquitin binding by the acidic loops of Ube2g1 and Ube2r1 enzymes distinguishes their Lys-48-ubiquitylation activities
21628527 study reports that UBCH8 and UBE2G1 and UBE2G2 cooperate with CRL4Cdt2 in promoting the polyubiquitylation and subsequent degradation of p21 and Cdt1, respectively
12933904 In endoplasmic reticulum, involved in the degradation of type 2 iodothyronine selenodeiodinase

AA Sequence

MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPP      1 - 70
KMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVD     71 - 140
AAKEWREDRNGEFKRKVARCVRKSQETAFE                                            141 - 170
//

Text Mined References (23)

PMID Year Title
25471371 2015 Differential ubiquitin binding by the acidic loops of Ube2g1 and Ube2r1 enzymes distinguishes their Lys-48-ubiquitylation activities.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21628527 2011 Selective ubiquitylation of p21 and Cdt1 by UBCH8 and UBE2G ubiquitin-conjugating enzymes via the CRL4Cdt2 ubiquitin ligase complex.
21269460 2011 Initial characterization of the human central proteome.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
19103148 2009 CYP3A4 ubiquitination by gp78 (the tumor autocrine motility factor receptor, AMFR) and CHIP E3 ligases.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15673284 2005 TEB4 is a C4HC3 RING finger-containing ubiquitin ligase of the endoplasmic reticulum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...