Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.17
PubTator Score 3.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.300 2.1e-04
atypical teratoid / rhabdoid tumor 1.200 3.0e-06
Breast cancer 2.100 4.7e-02
esophageal adenocarcinoma -1.400 1.8e-02
group 3 medulloblastoma 1.400 3.9e-04
lung cancer 1.500 1.5e-03
Multiple myeloma 2.167 8.2e-04
non primary Sjogren syndrome sicca 1.100 2.5e-02
ovarian cancer -1.400 9.0e-04
pancreatic ductal adenocarcinoma liver m... -1.701 6.4e-03
psoriasis 1.900 7.0e-05
spina bifida -1.327 4.4e-02
tuberculosis and treatment for 6 months 1.200 1.9e-05

Gene RIF (3)

AA Sequence

MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPP      1 - 70
KMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVD     71 - 140
AAKEWREDRNGEFKRKVARCVRKSQETAFE                                            141 - 170
//

Text Mined References (24)

PMID Year Title