Property Summary

NCBI Gene PubMed Count 34
PubMed Score 159.68
PubTator Score 158.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P62249 B2RDD5 P17008
Symbols S16

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

Gene RIF (6)

PMID Text
26362536 HIV-1 Gag interacts with RPL27AP6 as demonstrated by proximity dependent biotinylation proteomics
25893343 Report dysregulated expression of RPS16 in disc degeneration.
20198863 Results obtained support the possibility of the autoregulation of rpS13 pre-mRNA splicing through feedback mechanism.
19773262 Observational study of gene-disease association. (HuGE Navigator)
19559069 Data demonstrated that while ribosomal proteins S16 and S5 is able to bind to the 18S rRNA independently, their simultaneous binding has a noticeable synergetic effect.
18318121 RpS16 was shown to specifically bind to the transcript forming a stable complex with the apparent dissociation constant of (1.3 +/- 0.1) x 10(-8) M at 20 degrees C.

AA Sequence

MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAGVDIRV      1 - 70
RVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCESKKFGGPGARAR     71 - 140
YQKSYR                                                                    141 - 146
//

Text Mined References (37)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25893343 2015 Dysregulated COL3A1 and RPL8, RPS16, and RPS23 in Disc Degeneration Revealed by Bioinformatics Methods.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20198863 [Human ribosomal protein S16 inhibites excision of the first intron from its own].
More...