Property Summary

NCBI Gene PubMed Count 34
PubMed Score 172.67
PubTator Score 158.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 4.9e-06
glioblastoma 1.100 1.6e-05
intraductal papillary-mucinous neoplasm ... -1.500 9.2e-04
lung cancer 1.400 1.7e-03
medulloblastoma 1.100 5.8e-04
medulloblastoma, large-cell 1.800 8.0e-06
Multiple myeloma 1.793 4.4e-03
osteosarcoma -1.489 6.7e-05
ovarian cancer -1.800 2.0e-05
primitive neuroectodermal tumor 1.100 2.9e-05
Waldenstrons macroglobulinemia 1.413 2.4e-02

Synonym

Accession P62249 B2RDD5 P17008
Symbols S16

Gene

PDB

5VYC   4UG0   4V6X   5AJ0   5LKS   5T2C   5A2Q   5FLX   5OA3  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (6)

AA Sequence

MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAGVDIRV      1 - 70
RVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCESKKFGGPGARAR     71 - 140
YQKSYR                                                                    141 - 146
//

Text Mined References (38)

PMID Year Title