Property Summary

NCBI Gene PubMed Count 34
PubMed Score 172.67
PubTator Score 158.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 4.9e-06
glioblastoma 1.100 1.6e-05
intraductal papillary-mucinous neoplasm ... -1.500 9.2e-04
lung cancer 1.400 1.7e-03
medulloblastoma 1.100 5.8e-04
medulloblastoma, large-cell 1.800 8.0e-06
Multiple myeloma 1.793 4.4e-03
osteosarcoma -1.489 6.7e-05
ovarian cancer -1.800 2.0e-05
primitive neuroectodermal tumor 1.100 2.9e-05
Waldenstrons macroglobulinemia 1.413 2.4e-02

Gene RIF (6)

AA Sequence

MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAGVDIRV      1 - 70
RVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCESKKFGGPGARAR     71 - 140
YQKSYR                                                                    141 - 146
//

Text Mined References (38)

PMID Year Title