Property Summary

NCBI Gene PubMed Count 27
PubMed Score 30.52
PubTator Score 10.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.400 5.1e-04
Breast cancer -1.200 3.9e-09
cystic fibrosis -1.300 1.4e-04
glioblastoma -1.700 1.4e-03
group 3 medulloblastoma 1.100 7.8e-03
intraductal papillary-mucinous adenoma (... -1.200 1.6e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.2e-02
lung adenocarcinoma -1.200 1.3e-07
osteosarcoma -1.187 9.9e-04
ovarian cancer -2.100 1.7e-06
subependymal giant cell astrocytoma -1.193 1.9e-02

Gene RIF (7)

AA Sequence

MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLN      1 - 70
KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHTGGKILGFFF               71 - 130
//

Text Mined References (31)

PMID Year Title