Property Summary

NCBI Gene PubMed Count 23
PubMed Score 29.16
PubTator Score 10.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession P62244 P39027 P39031 Q3MHD9 Q8C023 Q9BV24
Symbols S15a

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

Gene RIF (3)

PMID Text
25833696 we identify RPS15A as a novel potential oncogenic gene involved in lung carcinogenesis.
25409460 The crucial role of RPS15A in promoting osteosarcoma cell proliferation.
24334120 RPS15A may play a prominent role in heptocarcinogenesis and serve as a potential therapeutic target in hepatocellular carcinoma.

AA Sequence

MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLN      1 - 70
KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHTGGKILGFFF               71 - 130
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25833696 2015 Decreased expression of RPS15A suppresses proliferation of lung cancer cells.
25409460 2014 Ribosomal protein S15A augments human osteosarcoma cell proliferation in vitro.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24334120 2014 Down-regulation of ribosomal protein S15A mRNA with a short hairpin RNA inhibits human hepatic cancer cell growth in vitro.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...