Property Summary

NCBI Gene PubMed Count 25
PubMed Score 67.74
PubTator Score 22.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Gene RIF (2)

AA Sequence

MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGGNKKYRALRLDVGNFSWGSE      1 - 70
CCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILNKK     71 - 140
RSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFYLRKIKARKGK      141 - 208
//

Text Mined References (36)

PMID Year Title