Property Summary

NCBI Gene PubMed Count 96
PubMed Score 52.17
PubTator Score 36.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Stevens-Johnson syndrome 92 0.0 0.0
Disease Target Count P-value
Multiple myeloma 1332 8.3e-04
ovarian cancer 8520 5.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cockayne syndrome 60 3.34 1.7
Photosensitive trichothiodystrophy 30 3.059 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.228 8.3e-04
ovarian cancer -1.100 5.7e-03

PDB (24)

Gene RIF (49)

AA Sequence

MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQG      1 - 70
SYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMV     71 - 140
EKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCT    141 - 210
FIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQL    211 - 280
DGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAEL    281 - 350
MPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK                  351 - 406
//

Text Mined References (109)

PMID Year Title