Property Summary

NCBI Gene PubMed Count 95
Grant Count 19
R01 Count 13
Funding $859,253.99
PubMed Score 49.57
PubTator Score 36.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.228 0.001
ovarian cancer 2.000 0.000

Gene RIF (51)

PMID Text
26592665 Our data suggest that PSMC5 facilitates the damaging effects of radiation in radiation-responsive H460 cancer cells and therefore may serve as a prognostic indicator for radiotherapy and molecular targeted therapy in lung cancer patients.
26519477 results demonstrate that PSMC5 is a new and important player involved in regulating ERK1/2 signal transmission through the remodeling of Shoc2 scaffold complex in a spatially-defined manner.
26469385 HIV-1 MA downregulates PSMC5 gene expression in HepG2 cells
25739698 XopJ has protease activity to specifically degrade RPT6.
24528651 TRIP-1 regulates fibroblast acquisition of phenotype and function associated with myofibroblasts.
24482233 gamma-aminobutyric acidB receptor proteasomal degradation is mediated by the interaction of the GABAB2 C terminus with the proteasomal ATPase Rtp6 and regulated by neuronal activity
23032291 Rpt6 interacts directly with CKIP-1 and promotes the turnover of Smurf1.
22771340 Sug1 plays a critical role in transcription of MHC class I, and the MHC class II-like molecules, HLA-DM and HLA-DO.
20424172 Caspase-3 cleaves specific 19 S proteasome subunits in skeletal muscle stimulating proteasome activity
19660582 Findings show that Sug1 is crucial for regulating histone H3K4me3 and H3R17me2 at the cytokine inducible MHC-II and CIITA promoters.
More...

AA Sequence

MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQG      1 - 70
SYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMV     71 - 140
EKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCT    141 - 210
FIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQL    211 - 280
DGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAEL    281 - 350
MPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK                  351 - 406
//

Text Mined References (104)

PMID Year Title
26592665 2016 Radiosensitizing effect of PSMC5, a 19S proteasome ATPase, in H460 lung cancer cells.
26519477 2015 Spatial control of Shoc2-scaffold-mediated ERK1/2 signaling requires remodeling activity of the ATPase PSMC5.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25739698 2015 The Xanthomonas campestris type III effector XopJ proteolytically degrades proteasome subunit RPT6.
25416956 2014 A proteome-scale map of the human interactome network.
24528651 2014 TRIP-1 via AKT modulation drives lung fibroblast/myofibroblast trans-differentiation.
24482233 2014 Proteasomal degradation of ?-aminobutyric acidB receptors is mediated by the interaction of the GABAB2 C terminus with the proteasomal ATPase Rtp6 and regulated by neuronal activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23824326 2013 USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...