Property Summary

NCBI Gene PubMed Count 66
PubMed Score 13.51
PubTator Score 10.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Congestive heart failure 113 0.0 0.9

Expression

Protein-protein Interaction (8)

Gene RIF (30)

AA Sequence

MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKD      1 - 70
YLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVD     71 - 140
KDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEY    141 - 210
YEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPS    211 - 280
IVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRK    281 - 350
IEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK    351 - 420
KSKENVLYKKQEGTPEGLYL                                                      421 - 440
//

Text Mined References (80)

PMID Year Title