Property Summary

NCBI Gene PubMed Count 49
Grant Count 34
R01 Count 7
Funding $3,208,312.32
PubMed Score 253.46
PubTator Score 122.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma -1.800 0.000
ependymoma -2.200 0.000
oligodendroglioma -2.000 0.000
glioblastoma -2.600 0.000
osteosarcoma 1.355 0.001
medulloblastoma -2.600 0.000
non diabetic and post-ischemic heart fai... -1.100 0.036
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -2.100 0.000
tuberculosis -1.200 0.000
lung cancer 1.100 0.001
adult high grade glioma -2.600 0.000
pilocytic astrocytoma -2.900 0.000
lung adenocarcinoma 1.500 0.000
inflammatory breast cancer 1.100 0.037
Pick disease 1.200 0.001
ovarian cancer 1.200 0.000

Gene RIF (24)

PMID Text
27033453 Lithium normalizes gamma band oscillations mediated by P/Q-type calcium channels modulated by NCS-1.
26153708 Study determined the salient features of the folding free-energy landscapes of the Mg2+-bound and apo states of NCS-1
25565019 A strong liason was characterized between myristoylation and cryptic EF-1 in NCS-1.
25343687 results reveal the important role of salt bridges on the structural properties of NCS-1 protein and that R102Q mutation disables the dynamic relocation of C-terminus, which may block the binding of NCS-1 protein to its receptors
25157171 single-molecule optical tweezers were used to monitor misfolding reactions of the human neuronal calcium sensor-1.
24934288 The functional link in substantia nigra dopamine neurons between Cav1.3- L-type-Ca2+ channels and D2-autoreceptor activity is an adaptive signalling network controlled by NCS-1.
24012477 NCS1 has evolved a remarkable complex interdomain cooperativity and a fundamentally different folding mechanism compared to structurally related proteins.
22999924 data suggest that genetic variants in the NCS-1 gene contribute to susceptibility of Cocaine Abuse in individuals of African descent.
22227393 the C-terminal tail is important for regulating the conformational stability of NCS1 in Ca(2+)-activated state
21875085 analysis of the interaction between the D2 dopamine receptor and neuronal calcium sensor-1
More...

AA Sequence

MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFN      1 - 70
VFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPE     71 - 140
EENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV                        141 - 190
//

Text Mined References (52)

PMID Year Title
27033453 2016 Lithium decreases the effects of neuronal calcium sensor protein 1 in pedunculopontine neurons.
26705828 2016 Membrane binding of Neuronal Calcium Sensor-1 (NCS1).
26153708 2015 Single-molecule folding mechanisms of the apo- and Mg(2+)-bound states of human neuronal calcium sensor-1.
25565019 2015 Liaison between myristoylation and cryptic EF-hand motif confers Ca(2+) sensitivity to neuronal calcium sensor-1.
25416956 2014 A proteome-scale map of the human interactome network.
25343687 2014 R102Q mutation shifts the salt-bridge network and reduces the structural flexibility of human neuronal calcium sensor-1 protein.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25157171 2014 Direct single-molecule observation of calcium-dependent misfolding in human neuronal calcium sensor-1.
24934288 2014 Cav1.3 channels control D2-autoreceptor responses via NCS-1 in substantia nigra dopamine neurons.
24012477 2013 Single-molecule folding mechanism of an EF-hand neuronal calcium sensor.
More...