Property Summary

NCBI Gene PubMed Count 51
PubMed Score 263.21
PubTator Score 122.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.600 3.7e-06
astrocytic glioma -1.300 9.8e-03
Astrocytoma, Pilocytic -1.100 1.0e-04
atypical teratoid / rhabdoid tumor -3.400 8.4e-11
ependymoma -1.300 2.2e-03
glioblastoma -2.100 8.4e-10
group 3 medulloblastoma -1.500 1.1e-02
inflammatory breast cancer 1.100 3.7e-02
lung adenocarcinoma 1.500 3.8e-06
lung cancer 1.100 1.1e-03
medulloblastoma, large-cell -2.800 3.7e-06
non diabetic and post-ischemic heart fai... -1.100 3.6e-02
oligodendroglioma -1.200 1.9e-02
osteosarcoma 1.355 7.0e-04
ovarian cancer 1.200 1.5e-10
Pick disease 1.200 1.0e-03
primitive neuroectodermal tumor -2.100 2.0e-05
tuberculosis -1.200 7.8e-06

Gene RIF (26)

AA Sequence

MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFN      1 - 70
VFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPE     71 - 140
EENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV                        141 - 190
//

Text Mined References (54)

PMID Year Title