Property Summary

NCBI Gene PubMed Count 131
PubMed Score 5075.88
PubTator Score 609.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.35600438658201E-16
oligodendroglioma 2849 1.85507306129527E-16
posterior fossa group A ependymoma 1511 2.35372918131246E-14
lung adenocarcinoma 2714 2.23955035873527E-10
Breast cancer 3099 6.73958402601776E-10
atypical teratoid / rhabdoid tumor 4369 2.8568555567848E-8
pediatric high grade glioma 2712 5.36707282024556E-8
atypical teratoid/rhabdoid tumor 1095 1.10508885004409E-7
Pick disease 1893 1.98242288066033E-7
Amyotrophic Lateral Sclerosis 432 1.02694975161161E-6
osteosarcoma 7933 1.65265897078906E-6
colon cancer 1475 2.29713441757585E-6
pituitary cancer 1972 4.67398053255799E-6
psoriasis 6685 8.97464306028792E-6
primitive neuroectodermal tumor 3031 2.48129514905724E-5
medulloblastoma, large-cell 6234 2.86487185879245E-5
ovarian cancer 8492 3.44391066949675E-5
acute quadriplegic myopathy 1157 5.67154402802675E-5
nasopharyngeal carcinoma 1056 9.38244808296948E-5
adult high grade glioma 2148 1.53185184374381E-4
ulcerative colitis 2087 8.44917112292493E-4
Crohn's disease 304 8.8671087942808E-4
Multiple myeloma 1328 0.00124175767106502
hepatocellular carcinoma 550 0.00125366303688855
subependymal giant cell astrocytoma 2287 0.00285065596862646
pilocytic astrocytoma 3086 0.00308193725949259
pancreatic cancer 2300 0.00334717474706102
pancreatic carcinoma 567 0.00334717474706117
glioblastoma 5572 0.00467341419290119
astrocytic glioma 2241 0.00725684751433071
group 3 medulloblastoma 2254 0.00826335748661724
Waldenstrons macroglobulinemia 765 0.00919646198401225
astrocytoma 1493 0.0130594102787749
Rheumatoid Arthritis 1171 0.0210959294441019
Gaucher disease type 1 171 0.022072778023928
chronic rhinosinusitis 512 0.0394818265401774
lung cancer 4473 0.0452715394617715
Disease Target Count Z-score Confidence
Long QT syndrome 53 3.487 1.7

Expression

  Differential Expression (37)

Disease log2 FC p
Rheumatoid Arthritis 1.600 0.021
hepatocellular carcinoma -1.500 0.001
pancreatic cancer -1.300 0.003
Waldenstrons macroglobulinemia 1.278 0.009
Multiple myeloma 1.782 0.001
astrocytic glioma -1.400 0.007
astrocytoma -1.900 0.013
posterior fossa group B ependymoma -2.200 0.000
posterior fossa group A ependymoma -1.500 0.000
oligodendroglioma -1.400 0.000
psoriasis -4.700 0.000
glioblastoma -1.800 0.000
osteosarcoma -2.899 0.000
group 3 medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
atypical teratoid/rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -1.100 0.001
Crohn's disease -1.048 0.001
ulcerative colitis -1.232 0.001
Amyotrophic Lateral Sclerosis 1.430 0.000
acute quadriplegic myopathy 1.540 0.000
lung cancer -2.400 0.045
colon cancer -1.600 0.000
Breast cancer 5.100 0.030
adult high grade glioma -1.800 0.000
pediatric high grade glioma -1.700 0.000
pilocytic astrocytoma -1.400 0.000
pancreatic carcinoma -1.300 0.003
subependymal giant cell astrocytoma -2.106 0.009
lung adenocarcinoma -1.200 0.000
nasopharyngeal carcinoma -1.100 0.000
Pick disease -1.500 0.004
ovarian cancer -1.100 0.000
Gaucher disease type 1 1.500 0.022
pituitary cancer 1.200 0.000
chronic rhinosinusitis -1.003 0.039

Synonym

Accession P62158 P02593 P70667 P99014 Q13942 Q53S29 Q61379 Q61380 Q96HK3 CaM
Symbols CaM
PHKD
PHKD3
CaMIII
HEL-S-72

Gene

PDB

2N6A   2VAY   1WRZ   1ZUZ   2WEL   5I0I   1YR5   2X0G   2Y4V   5J03   2BE6   2F3Y   2F3Z   2LQC   3G43   3OXQ   2LGF   4UMO   4V0C   3EWT   2JZI   2R28   2W73   4Q5U   1AJI   1CDL   1CLL   1CTR   1IWQ   1J7O   1J7P   1K90   1K93   1L7Z   1LVC   1NKF   1PK0   1S26   1SK6   1SW8   1XFU   1XFV   1XFW   1XFX   1XFY   1XFZ   1Y6W   1YRT   1YRU   1ZOT   2HF5   2I08   2K0E   2K0F   2K0J   2K61   2KNE   2KUG   2KUH   2L53   2L7L   2LL6   2LL7   2LQP   2LV6   2M0J   2M0K   2M55   2MG5   2N27   2V01   2V02   3BYA   3DVE   3DVJ   3DVK   3DVM   3EWV   3HR4   3J41   3O77   3O78   3SUI   3UCT   3UCW   3UCY   4BW7   4BW8   4BYF   4DCK   4DJC   4GOW   4JPZ   4JQ0   4L79   4LZX   4M1L   4OVN   4Q57   4UPU   5COC   5DOW   5K7L   5K8Q  

Gene RIF (32)

PMID Text
25460178 CALM3 had the highest ranking in the 1629-gene LQTS nodal network of the 7 genes identified through our filtering process.
25396734 the association of EGFR, CALM3 and SMARCD1 gene polymorphisms with bone mineral density in white women, as conducted.
23077317 An HIV-1 MA peptide (residues 8-43) binds to CaM with a very high affinity with dissociation constant 25 nm
21980498 Differentiation paralleled the activation of Wnt5/Calmodulin signalling by autocrine/paracrine intense secretion of Wnt5a and Wnt5b
21799007 An HIV-1 MA peptide (residues 8-43) binds to CaM with a very high affinity with dissociation constant 25 nm
21047202 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20956522 An HIV-1 MA peptide (residues 8-43) binds to CaM with a very high affinity with dissociation constant 25 nm
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379146 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20012528 An HIV-1 MA peptide (residues 8-43) binds to CaM with a very high affinity with dissociation constant 25 nm
More...

AA Sequence

MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL      1 - 70
TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE     71 - 140
EFVQMMTAK                                                                 141 - 149
//

Text Mined References (146)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25460178 2015 CALM3 mutation associated with long QT syndrome.
25416956 2014 A proteome-scale map of the human interactome network.
25396734 2014 Comprehensive analysis of the association of EGFR, CALM3 and SMARCD1 gene polymorphisms with BMD in Caucasian women.
25268113 2014 The individual N- and C-lobes of calmodulin tether to the Cav1.2 channel and rescue the channel activity from run-down in ventricular myocytes of guinea-pig heart.
24917665 2014 Novel calmodulin mutations associated with congenital arrhythmia susceptibility.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...