Property Summary

Ligand Count 6
NCBI Gene PubMed Count 137
PubMed Score 5859.51
PubTator Score 609.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Long QT syndrome 1 20 0.0 5.0

Expression

  Differential Expression (32)

Disease log2 FC p
acute quadriplegic myopathy 1.373 4.1e-04
adult high grade glioma -1.700 1.7e-06
Amyotrophic lateral sclerosis 1.365 1.6e-06
astrocytic glioma -1.100 6.5e-03
Astrocytoma, Pilocytic -1.200 4.1e-08
atypical teratoid / rhabdoid tumor -1.400 3.8e-05
Breast cancer 3.300 3.4e-02
chronic rhinosinusitis -1.003 3.9e-02
colon cancer -1.300 7.3e-03
Crohn's disease -1.048 8.9e-04
ependymoma -1.400 6.0e-03
glioblastoma -1.500 1.6e-09
group 3 medulloblastoma -2.100 8.3e-03
hepatocellular carcinoma -1.500 1.3e-03
lung adenocarcinoma -1.200 2.2e-10
lung cancer -1.400 4.2e-04
medulloblastoma, large-cell -1.700 1.5e-04
Multiple myeloma 1.782 1.2e-03
nasopharyngeal carcinoma -1.100 9.4e-05
oligodendroglioma -1.400 1.9e-02
osteosarcoma 1.064 3.0e-04
ovarian cancer -1.300 1.2e-04
pancreatic cancer -1.300 3.3e-03
pancreatic carcinoma -1.300 3.3e-03
Pick disease 1.700 2.0e-07
pituitary cancer 1.200 4.7e-06
primitive neuroectodermal tumor -1.300 2.5e-05
psoriasis -1.600 1.7e-04
Rheumatoid arthritis 1.600 2.1e-02
subependymal giant cell astrocytoma -1.919 5.8e-03
ulcerative colitis -1.232 8.4e-04
Waldenstrons macroglobulinemia 1.278 9.2e-03

Protein-protein Interaction (4)

PDB (115)

Gene RIF (34)

AA Sequence

MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL      1 - 70
TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE     71 - 140
EFVQMMTAK                                                                 141 - 149
//

Text Mined References (154)

PMID Year Title