Property Summary

Ligand Count 6
NCBI Gene PubMed Count 137
PubMed Score 5859.51
PubTator Score 609.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Long QT syndrome 1 20 0.0 5.0

Expression

  Differential Expression (32)

Disease log2 FC p
acute quadriplegic myopathy 1.373 4.1e-04
adult high grade glioma -1.700 1.7e-06
Amyotrophic lateral sclerosis 1.365 1.6e-06
astrocytic glioma -1.100 6.5e-03
Astrocytoma, Pilocytic -1.200 4.1e-08
atypical teratoid / rhabdoid tumor -1.400 3.8e-05
Breast cancer 3.300 3.4e-02
chronic rhinosinusitis -1.003 3.9e-02
colon cancer -1.300 7.3e-03
Crohn's disease -1.048 8.9e-04
ependymoma -1.400 6.0e-03
glioblastoma -1.500 1.6e-09
group 3 medulloblastoma -2.100 8.3e-03
hepatocellular carcinoma -1.500 1.3e-03
lung adenocarcinoma -1.200 2.2e-10
lung cancer -1.400 4.2e-04
medulloblastoma, large-cell -1.700 1.5e-04
Multiple myeloma 1.782 1.2e-03
nasopharyngeal carcinoma -1.100 9.4e-05
oligodendroglioma -1.400 1.9e-02
osteosarcoma 1.064 3.0e-04
ovarian cancer -1.300 1.2e-04
pancreatic cancer -1.300 3.3e-03
pancreatic carcinoma -1.300 3.3e-03
Pick disease 1.700 2.0e-07
pituitary cancer 1.200 4.7e-06
primitive neuroectodermal tumor -1.300 2.5e-05
psoriasis -1.600 1.7e-04
Rheumatoid arthritis 1.600 2.1e-02
subependymal giant cell astrocytoma -1.919 5.8e-03
ulcerative colitis -1.232 8.4e-04
Waldenstrons macroglobulinemia 1.278 9.2e-03

Synonym

Accession P0DP23 P02593 P62158 P70667 P99014 Q13942 Q53S29 Q61379 Q61380 Q96HK3
Symbols CaM
PHKD
PHKD3
CaMIII
HEL-S-72

Gene

PDB

2N6A   2VAY   1WRZ   1ZUZ   2WEL   5I0I   1YR5   2X0G   2Y4V   5J03   2BE6   2F3Y   2F3Z   2LQC   3G43   3OXQ   2LGF   4UMO   4V0C   3EWT   2JZI   2R28   2W73   4Q5U   2LL6   3HR4   5TP6   4LZX   4M1L   2N77   2M55   4JQ0   1AJI   1CDL   1CLL   1CTR   1IWQ   1J7O   1J7P   1K90   1K93   1L7Z   1LVC   1NKF   1PK0   1S26   1SK6   1SW8   1UP5   1XFU   1XFV   1XFW   1XFX   1XFY   1XFZ   1Y6W   1YRT   1YRU   1ZOT   2HF5   2I08   2K0E   2K0F   2K0J   2K61   2KNE   2KUG   2KUH   2L53   2L7L   2LL7   2LQP   2LV6   2M0J   2M0K   2MG5   2N27   2N8J   2V01   2V02   3BYA   3DVE   3DVJ   3DVK   3DVM   3EWV   3J41   3O77   3O78   3SUI   3UCT   3UCW   3UCY   4BW7   4BW8   4BYF   4DCK   4DJC   4GOW   4JPZ   4L79   4OVN   4Q57   4UPU   5COC   5DBR   5DOW   5DSU   5GGM   5J8H   5JQA   5JTH   5K7L   5K8Q   5TP5  

Protein-protein Interaction (4)

Gene RIF (34)

AA Sequence

MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL      1 - 70
TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE     71 - 140
EFVQMMTAK                                                                 141 - 149
//

Text Mined References (154)

PMID Year Title