Property Summary

NCBI Gene PubMed Count 66
Grant Count 6
R01 Count 4
Funding $284,383.47
PubMed Score 32.43
PubTator Score 27.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.200 0.002
hereditary spastic paraplegia -1.300 0.000
tuberculosis -1.400 0.000
colon cancer -1.300 0.001
pediatric high grade glioma 1.300 0.001
lung adenocarcinoma -1.900 0.000
spina bifida -1.420 0.046
Breast cancer -1.700 0.000

 MGI Term (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
463226 confirmatory 1 / 0 / 2 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: radiolabel-based biochemical counterscreen assay to determine activity of inhibitors on dephosphorylation of phosphohistone by PP1

Gene RIF (37)

PMID Text
26334248 These results suggest a unique functional role for the PP1beta isoform in affecting cardiac contractile function
25967976 Findings show that PP1cbeta plays a role in endothelial cell migration through a mechanism involving the interplay of actin cytoskeleton proteins and focal adhesion molecules signaling.
25849655 In the title.
25496916 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25073485 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25073485 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23382248 results indicate that SCN-iPS cells provide a useful disease model for SCN, and the activation of the Wnt3a/beta-catenin pathway may offer a novel therapy for SCN with ELANE mutation
23197154 PPP1C isoforms have distinct contribution to the outside-in alphaIIbbeta3 signalling-dependent functions in HEK293 alphaIIbbeta3 cells.
23168335 Interaction between protein phosphatase 1 beta and myosin phosphatase (MYPT)1 results in exclusion of Nkx2.5 from the cell nucleus.
22768081 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
More...

AA Sequence

MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD      1 - 70
LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECK     71 - 140
RRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDK    141 - 210
DVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGG    211 - 280
MMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR                           281 - 327
//

Text Mined References (80)

PMID Year Title
27264673 2016 A novel rasopathy caused by recurrent de novo missense mutations in PPP1CB closely resembles Noonan syndrome with loose anagen hair.
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26334248 2015 Cardiac-specific deletion of protein phosphatase 1? promotes increased myofilament protein phosphorylation and contractile alterations.
25967976 2015 Protein Phosphatase 1 Beta is Modulated by Chronic Hypoxia and Involved in the Angiogenic Endothelial Cell Migration.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849655 2015 The neuronal-specific SGK1.1 (SGK1_v2) kinase as a transcriptional modulator of BAG4, Brox, and PPP1CB genes expression.
25416956 2014 A proteome-scale map of the human interactome network.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
More...