Property Summary

NCBI Gene PubMed Count 76
PubMed Score 33.31
PubTator Score 27.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 2.7e-20
lung adenocarcinoma 2716 2.3e-14
tuberculosis 2010 1.1e-06
hereditary spastic paraplegia 318 3.2e-04
colon cancer 1478 1.2e-03
psoriasis 6694 1.9e-03
adult high grade glioma 3801 1.1e-02
spina bifida 1074 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Noonan syndrome 34 3.342 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.200 1.1e-02
Breast cancer -1.700 2.7e-20
colon cancer -1.300 1.2e-03
hereditary spastic paraplegia -1.300 3.2e-04
lung adenocarcinoma -1.900 2.3e-14
psoriasis -1.200 1.9e-03
spina bifida -1.420 4.6e-02
tuberculosis -1.400 1.1e-06

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (34)

AA Sequence

MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD      1 - 70
LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECK     71 - 140
RRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDK    141 - 210
DVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGG    211 - 280
MMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR                           281 - 327
//

Text Mined References (90)

PMID Year Title