Property Summary

Ligand Count 2
NCBI Gene PubMed Count 151
PubMed Score 138.97
PubTator Score 96.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma 1.067 1.0e-07
Multiple myeloma 1.318 3.2e-04
osteosarcoma -1.235 3.2e-04
ovarian cancer 1.500 6.3e-05
Waldenstrons macroglobulinemia 1.014 1.3e-02

PDB (13)

Gene RIF (76)

AA Sequence

MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYY      1 - 70
DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDEC     71 - 140
KRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPD    141 - 210
KDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG    211 - 280
AMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK                        281 - 330
//

Text Mined References (168)

PMID Year Title