Property Summary

NCBI Gene PubMed Count 133
Grant Count 40
R01 Count 25
Funding $5,294,435.19
PubMed Score 136.63
PubTator Score 96.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.014 0.013
Multiple myeloma 1.318 0.000
osteosarcoma -1.235 0.000
lung adenocarcinoma 1.067 0.000
ovarian cancer 1.500 0.000

MLP Assay (22)

AID Type Active / Inconclusive / Inactive Description
2235 screening 2846 / 0 / 312255 Counterscreen for inhibitors of PP5: fluorescence-based biochemical high throughput primary assay to identify inhibitors of Protein Phosphatase 1 (PP1).
2355 screening 19 / 0 / 443 Counterscreen for inhibitors of PP5: fluorescence-based biochemical high throughput assay for inhibitors of Protein Phosphatase 1 (PP1), in triplicate.
2358 screening 1007 / 0 / 937 Fluorescence-based biochemical high throughput confirmation assay to identify inhibitors of Protein Phosphatase 1 (PP1)
2394 confirmatory 1 / 0 / 59 Counterscreen for inhibitors of PP5: fluorescence-based biochemical high throughput dose response assay for inhibitors of Protein Phosphatase 1 (PP1)
2403 confirmatory 62 / 0 / 5 Fluorescence-based biochemical high throughput dose response assay to identify inhibitors of Protein Phosphatase 1 (PP1)
504644 summary 0 / 0 / 0 Summary of probe development efforts to identify inhibitors of protein phosphatase 1 (PP1)
624436 other 0 / 0 / 11 Late stage assay provider counterscreen for the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical assay to determine activity of inhibitors on dephosphorylation of OMFP by PP1 (Round 5)
624437 other 0 / 0 / 7 Late stage assay provider counterscreen for the probe development effort to identify inhibitors of PP5: radiolabel-based biochemical assay to determine activity of inhibitors on dephosphorylation of phosphohistone by PP1 (Round 5)
624446 confirmatory 0 / 0 / 1 Late stage assay provider counterscreen for the probe development effort to identify inhibitors of PP5: radiolabel-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of phosphohistone by PP1 (Round 5)
652109 other 32 / 0 / 32 Late stage assay provider results from the probe development effort to identify inhibitors of PP1: fluorescence-based biochemical assay to determine activity of inhibitors on dephosphorylation of OMFP by PP1
More...

Gene RIF (74)

PMID Text
26592247 Both PP-1 and PP-2A are directly involved in regulating eye development, and are aberrantly expressed in cataract and glaucoma patients. (Review)
26491017 activation of the Nherf1-PP1alpha-TAZ pathway in osteoblasts is targeted by histone deacetylase inhibitors
26116754 PARD3 promotes interaction between PP1A and LATS1 to induce LATS1 dephosphorylation and inactivation,leading to dephosphorylation and activation of TAZ
26083323 ATG16L1 as a bona fide physiological CSNK2 and PPP1 substrate, which reveals a novel molecular link from CSNK2 to activation of the autophagy-specific ATG12-ATG5-ATG16L1 complex and autophagy induction
26033480 Protein phosphatase 1 (PP1) activity is critical for radiosensitization in non-small cell lung cancer cells and PP1 activators can serve as promising radiosensitizers to improve therapeutic efficacy.
25979969 Data suggest that activation of TAZ (tafazzin) inhibits adipogenesis in mesenchymal stem cells; interaction of TAZ and protein phosphatases (PP1A, PP2A) up-regulates dephosphorylation and transport of TAZ to cell nucleus.
25556058 PP1alpha is an important proximal effector of Manumycin-A mediated lymphoma cell apoptosis.
25496916 Protein phosphatase 1, catalytic subunit, alpha isoform (PPP1CA) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25073485 Protein phosphatase 1, catalytic subunit, alpha isoform (PPP1CA) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25073485 Protein phosphatase 1, catalytic subunit, alpha isoform (PPP1CA) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
More...

AA Sequence

MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYY      1 - 70
DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDEC     71 - 140
KRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPD    141 - 210
KDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG    211 - 280
AMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK                        281 - 330
//

Text Mined References (150)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26592247 2015 Regulation of Eye Development by Protein Serine/Threonine Phosphatases-1 and -2A.
26491017 2015 Histone Deacetylase Inhibitors Target the Leukemic Microenvironment by Enhancing a Nherf1-Protein Phosphatase 1?-TAZ Signaling Pathway in Osteoblasts.
26116754 2015 PARD3 induces TAZ activation and cell growth by promoting LATS1 and PP1 interaction.
26083323 2015 ATG16L1 phosphorylation is oppositely regulated by CSNK2/casein kinase 2 and PPP1/protein phosphatase 1 which determines the fate of cardiomyocytes during hypoxia/reoxygenation.
26033480 2015 Inflammation-induced radioresistance is mediated by ROS-dependent inactivation of protein phosphatase 1 in non-small cell lung cancer cells.
25979969 2015 A cell-based screening for TAZ activators identifies ethacridine, a widely used antiseptic and abortifacient, as a compound that promotes dephosphorylation of TAZ and inhibits adipogenesis in C3H10T1/2 cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25556658 2015 Dynamic phosphorylation of CENP-A at Ser68 orchestrates its cell-cycle-dependent deposition at centromeres.
25556058 2015 The natural tumorcide Manumycin-A targets protein phosphatase 1? and reduces hydrogen peroxide to induce lymphoma apoptosis.
More...