Property Summary

NCBI Gene PubMed Count 37
PubMed Score 69.49
PubTator Score 28.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.500 3.9e-03
mucosa-associated lymphoid tissue lympho... -1.061 3.8e-02

Protein-protein Interaction (6)

Gene RIF (6)

AA Sequence

MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKEIEVGGGRKAIIIFVPVPQLK      1 - 70
SFQKIQVRLVRELEKKFSGKHVVFIAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIV     71 - 140
GKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL                    141 - 194
//

Text Mined References (48)

PMID Year Title