Property Summary

NCBI Gene PubMed Count 15
PubMed Score 27.65
PubTator Score 16.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.800 4.5e-02
lung cancer 1.500 5.1e-03
ovarian cancer 1.600 1.8e-04

Gene RIF (5)

AA Sequence

MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLT      1 - 70
ELSMQDEELMKRVQQSSGPA                                                       71 - 90
//

Text Mined References (19)

PMID Year Title