Property Summary

NCBI Gene PubMed Count 15
PubMed Score 27.16
PubTator Score 16.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Rhabdomyosarcoma 29
Disease Target Count P-value
lung cancer 4473 2.54568529870019E-5
ovarian cancer 8492 1.83598586125454E-4
acute myeloid leukemia 785 0.0451585996216432
Disease Target Count Z-score Confidence
Deafness dystonia syndrome 20 5.547 2.8
Dystonia 77 3.657 1.8
Barth syndrome 23 3.29 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 2.000 0.000
acute myeloid leukemia -1.800 0.045
ovarian cancer 1.600 0.000

Synonym

Accession P62072 A8K136 Q9WV99 Q9WVA0 Q9Y5J8
Symbols TIM10
TIM10A
TIMM10A

Gene

PDB

2BSK  

  Ortholog (13)

Gene RIF (5)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human translocase of inner mitochondrial membrane 10 homolog (yeast) (TIMM10) at amino acid residues 72-73 by the HIV-1 protease
20877624 Observational study of gene-disease association. (HuGE Navigator)
16669873 Marked differences in the expression of PTMA and Tim10 were observed during the differentiation of human primary skeletal muscle cells.
16387659 The crystal structure of TIM9.10 described here reveals a previously undescribed alpha-propeller topology in which helical "blades" radiate from a narrow central pore lined with polar residues.
14726512 in contrast to yeast, only a small fraction of Tim9-Tim10a-Tim10b complex is in a stable association with Tim22

AA Sequence

MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLT      1 - 70
ELSMQDEELMKRVQQSSGPA                                                       71 - 90
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16669873 2006 Identification of novel genes expressed during rhabdomyosarcoma differentiation using cDNA microarrays.
16387659 2006 Crystal structure of the mitochondrial chaperone TIM9.10 reveals a six-bladed alpha-propeller.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...