Property Summary

NCBI Gene PubMed Count 36
Grant Count 22
Funding $2,310,347.22
PubMed Score 39.55
PubTator Score 25.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.408 0.018
malignant mesothelioma -1.100 0.000
invasive ductal carcinoma -2.100 0.008
spina bifida -2.187 0.045
Breast cancer -1.200 0.002
ulcerative colitis -1.500 0.000
ovarian cancer -1.900 0.000

Gene RIF (11)

PMID Text
24826867 R-Ras2 has a role in both primary breast tumorigenesis and the late metastatic steps of cancer cells in the lung parenchyma.
24148564 R-RAS2 is overexpressed in the early stages of malignancy in tumors of the human central nervous system.
21781067 This article is the first study demonstrating expression of TC21 in human skin malignant tumors and suggests that TC21 is more expressed in highly aggressive skin tumors.
21085126 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20811707 Suggest that TC21 promotes cell motility and metastasis by regulating the expression of E-cadherin and N-cadherin in hepatocellular carcinoma and is associated with tumor progression and poor prognosis in HCC.
19692568 RasGRF GEFs can activate TC21 in all sublocalizations except the Golgi complex. Farnesylated TC21 can be activated by RasGRF1 & RasGRF2, but geranylgeranylated TC21 is unresponsive to RasGRF2.
19561613 TC21 directly links antigen receptors to PI(3)K-mediated survival pathways.
19460752 Knockdown of related RAS viral (r-ras) oncogene homolog 2 (RRAS2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19047159 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTA      1 - 70
GQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQE     71 - 140
EGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF          141 - 204
//

Text Mined References (46)

PMID Year Title
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
25208829 2014 Genome-wide association study of vitamin D levels in children: replication in the Western Australian Pregnancy Cohort (Raine) study.
24826867 2014 Contribution of the R-Ras2 GTP-binding protein to primary breast tumorigenesis and late-stage metastatic disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24148564 2013 R-RAS2 overexpression in tumors of the human central nervous system.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21781067 2011 Greater expression of TC21/R-ras2 in highly aggressive malignant skin cancer.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
More...