Property Summary

NCBI Gene PubMed Count 37
PubMed Score 42.90
PubTator Score 25.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (7)

Disease log2 FC p
ovarian cancer -1.900 5.2e-07
Breast cancer -1.200 2.1e-03
Chronic Lymphocytic Leukemia 1.408 1.8e-02
invasive ductal carcinoma -1.329 1.1e-03
malignant mesothelioma -1.100 4.4e-06
spina bifida -2.187 4.5e-02
ulcerative colitis -1.400 2.4e-07

Gene RIF (12)

AA Sequence

MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTA      1 - 70
GQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQE     71 - 140
EGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF          141 - 204
//

Text Mined References (47)

PMID Year Title